DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and LOC688542

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:XP_038954018.1 Gene:LOC688542 / 688542 RGDID:1587637 Length:559 Species:Rattus norvegicus


Alignment Length:705 Identity:183/705 - (25%)
Similarity:282/705 - (40%) Gaps:198/705 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QPG--HPEACALLVLLLLTSLWPDCCECLH-----GGSNTVKTKYGLLRGIVVRSSPL---VEAF 206
            :||  :...|.||:|:            ||     ..|....|..|.:||.:|.....   |..|
  Rat     6 RPGCLNAVTCGLLLLV------------LHVRGQDSASPIRNTHTGQVRGSLVHVKDTDIDVHTF 58

  Fly   207 LGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRL 271
            ||||:|.||||.|||.||..|..|..||.|.....:|.||        :.::.....::.:|  :
  Rat    59 LGIPFAKPPVGPLRFAPPEAPEPWSGVRDATSHPAMCLQN--------DNMMGSEDMKIMKL--I 113

  Fly   272 LPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELA 336
            ||.: :.||||||||||.|            |.....:.|..:|:|||.:......:.||||.||
  Rat   114 LPPI-SMSEDCLYLNIYAP------------THAHEGSNLPVMVWIHGGALTVGMASMYDGSMLA 165

  Fly   337 AHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGT 401
            |..:|:||||.:|||:.||..| |.|.|:||:|.:|.||.|.|:::|:..|||:|..:|:.|...
  Rat   166 ATEDVVVVTIQYRLGVLGFFST-GDEHARGNWGYLDQVAALRWVQQNIAHFGGNPNRVTIFGESA 229

  Fly   402 GAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLR 466
            |....:..||||::..|....::.||..:.|..|.::...|.|.||..:|| ..:..:.|..|||
  Rat   230 GGTSVSSHVVSPMSQGLFHGAIMESGVVVLPDLISRSSEMVYRIVANLSGC-AAVDSETLMQCLR 293

  Fly   467 TKSVAELLAVK---------VD------HPRFLVGFAPFVDGTVISPGANPLGSTTLPLGSAIVS 516
            .||.||:|.:.         ||      ||:.|:..|.|               ..:|   :|:.
  Rat   294 GKSEAEILDINKVFKIIPAVVDGEFLPKHPQELLASANF---------------HRVP---SIIG 340

  Fly   517 TSGIEYA-NFPKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHL--NEIFA 578
            .:..||. ..|   :||.          |||.:|    |..| :.|.|.:::.....:  .|...
  Rat   341 INNDEYGWILP---MIFD----------SAQKIE----EITR-KTLPTVLKSTALKMMLPPECGD 387

  Fly   579 VLKNEYT-DWEKAIRNPLSSRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKT--IEE 640
            :|..||. |.|    :|.:.:....:.:.|.....|.:::.:..... ...||..|:|::  .::
  Rat   388 LLMEEYMGDTE----DPKTLQAQFREMMGDFMFVIPALQVAHFQRSH-APVYFYEFQHRSSFFKD 447

  Fly   641 EYPQRSGSVRGEDVPFWLGLPMSPL-FPHNYTTQERQIGRLMLRYLSNFAKTGNPNQSTAKSVLP 704
            ..|....:..|::|....|..:..: |||  |.:|..:.|.:::|.:|||:.||||         
  Rat   448 VKPPHVKADHGDEVFLVFGYLVGDIKFPH--TEEEELLSRKIMKYWANFARHGNPN--------- 501

  Fly   705 NPNEVLETALHQQKKRSTSLTHPNLSEALNLAVLYNQRRSNAMHEKRSYIRRRLRSNDAAFTQLG 769
                                                                             
  Rat   502 ----------------------------------------------------------------- 501

  Fly   770 ISSERDVGSYDGDELPFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQ 824
                       .:.||.|...|..:| |::|..:.::....:..:|..|...:||
  Rat   502 -----------SEGLPHWPVMDHDDQ-YLQLDIQPSVGRALKARRLKFWTKTLPQ 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 164/554 (30%)
LOC688542XP_038954018.1 COesterase 30..538 CDD:395084 172/661 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.