DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and Bche

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:615 Identity:183/615 - (29%)
Similarity:275/615 - (44%) Gaps:130/615 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LLVLLLLTSLWPDCCECLHGGSNT-----VKTKYGLLRGIVVRSSPL----VEAFLGIPYASPPV 216
            ||.:|||..|:        |.|:|     :.||.|.:||:   |.|:    |.||||||||.||:
  Rat     8 LLWILLLCMLF--------GKSHTEEDVIITTKTGRVRGL---SMPILGGTVTAFLGIPYAQPPL 61

  Fly   217 GSLRFMPPITPSTWKTVRSADRFSPVCPQNI--PIP---------PNGPEALLEVPRARLAQLRR 270
            |||||..|...:.|..|.:|.:::..|.|||  ..|         ||                  
  Rat    62 GSLRFKKPQPLNKWPDVYNATKYANSCYQNIDQAFPGFQGSEMWNPN------------------ 108

  Fly   271 LLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTV-VFIHGESYDWNSGN--PYDG 332
                 .|.||||||||:::|.               ||.|.:|| |:::|..:...:.:  .|||
  Rat   109 -----TNLSEDCLYLNVWIPV---------------PKPKNATVMVWVYGGGFQTGTSSLPVYDG 153

  Fly   333 SELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLL 397
            ..|.....||||::|:|:|..|||...|...|.||.||.|....|.|::.|:.||||:|:|:||.
  Rat   154 KFLTRVERVIVVSMNYRVGALGFLAFPGNSEAPGNMGLFDQQLALQWIQRNIAAFGGNPKSVTLF 218

  Fly   398 GYGTGAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQKNPLFVKRR---VAEQTGCHGDMLYD 459
            |...||...::.::.|.:..|..|.:|.|||:.:|||: |:|...:.|   :|:..||..:. ..
  Rat   219 GESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAV-KHPEEARNRTLTLAKFIGCSKEN-EK 281

  Fly   460 DLAPCLRTKSVAEL-----LAVKVDHPRFLVGFAPFVDGTVISPGANPLGSTTLPLGSAIVSTSG 519
            ::..|||:|...|:     |.:..|..| .:.|.|.|||..::    .:..|.|.||.  |.|:.
  Rat   282 EIITCLRSKDPQEILLNEKLVLPSDSIR-SINFGPTVDGDFLT----DMPHTLLQLGK--VKTAQ 339

  Fly   520 IEYANFPKRDLIFCLTSVE-----SYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIF-- 577
            |             |..|.     ::|...|.    ||::.....|    .|..|...||..|  
  Rat   340 I-------------LVGVNKDEGTAFLVYGAP----GFSKDNDSLI----TRREFQEGLNMYFPG 383

  Fly   578 -AVLKNE-----YTDWEKAIRNPLSSRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHK 636
             :.|..|     |.|| ...:.|...|:|....:.|.:...|.::.....:.....|:|.:|:|:
  Rat   384 VSSLGKEAILFYYVDW-LGDQTPEVYREAFDDIIGDYNIICPALEFTKKFAELEINAFFYYFEHR 447

  Fly   637 TIEEEYPQRSGSVRGEDVPFWLGLPMSPLFPHNYTTQERQIGRLMLRYLSNFAKTGNPN----QS 697
            :.:..:|:..|.:.|.::.|..|||:....  |||..|....|.:::..:||||.|:||    .|
  Rat   448 SSKLPWPEWMGVMHGYEIEFVFGLPLERRV--NYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNS 510

  Fly   698 TAKSVLPNPNEVLETALHQQKKRSTSLTHP 727
            |...|..:..:...|...::.|.::.|..|
  Rat   511 TVWPVFTSTEQKYLTLNTEKSKINSKLRAP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 172/577 (30%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 176/594 (30%)
Aes <120..>272 CDD:223730 57/167 (34%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.