DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and alpha-Est5

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_001246965.1 Gene:alpha-Est5 / 40905 FlyBaseID:FBgn0261393 Length:543 Species:Drosophila melanogaster


Alignment Length:634 Identity:135/634 - (21%)
Similarity:214/634 - (33%) Gaps:217/634 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 AFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLR 269
            :|..||:|.||:|.|||..|:....|..|.....::                  |.|..|....|
  Fly    35 SFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHYA------------------EKPTQRGLLTR 81

  Fly   270 RLLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGESYD-WNSGNPYDGS 333
            .:     ...|||||||:|     .:|.::        :..|..:|:|:|.::. ..:.....|.
  Fly    82 EI-----EGGEDCLYLNVY-----SKQLKS--------EKPLPVMVYIYGGAFTVGEATRELYGP 128

  Fly   334 ELAAHGNVIVVTINFRLGIFGFLKTGGKE-SAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLL 397
            :.....:|::||:|:|:...|||...... ...||.||.|.|..|.|:|:.:..|.||..:||:.
  Fly   129 DYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNITVF 193

  Fly   398 GYGTGAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQKNP----LFVKRRVAEQTGCHGDMLY 458
            |...|....:.::.:.....|..:.:.:||:..:.||  .||    .|   |:|:|.|..|:   
  Fly   194 GESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWA--NNPAEDFAF---RLAQQNGFTGE--- 250

  Fly   459 DDLAPCLR------TKSVAELLAVKVDHPR--FLVGFAPFVDGTVISPGANP------------- 502
            :|.|..|.      .:.:.....:..:|.|  .|..|.|.|:..|......|             
  Fly   251 NDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCVVPKPPVEMARDAWSN 315

  Fly   503 -----LGSTT---------------------------LPLGSAIVST--SGIEY------ANF-- 525
                 ||.|:                           :|:....||:  ..:||      |.|  
  Fly   316 NFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVSSEKENLEYSQRLMKAYFGY 380

  Fly   526 --PKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWE 588
              |..:|:..:....||     :....|||.|...|:  |:.:...:|:..:..:...|.|    
  Fly   381 SPPSSELLLNMLDFYSY-----KIFWHGFNRTFNARL--TYAKAPTYYYRFDFDSPNFNFY---- 434

  Fly   589 KAIRNPLSSRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKTIEEEYPQRSGSVRGED 653
                                                  ||.|...|.||         |....:|
  Fly   435 --------------------------------------RAKFCGDKIKT---------GVAHADD 452

  Fly   654 VPFWLGLPMSPLFPH-----------NYTTQERQIGRLMLRYLSNFAKTGNPN---------QST 698
                    :|.||.:           .|.|.||.||     ..:.||.|.|||         :.:
  Fly   453 --------LSYLFRNAGSWKLDKTSAEYRTIERMIG-----IWTAFAATSNPNCPEIGHLEWKPS 504

  Fly   699 AKSVLPNPNEVLETALHQQKKRSTSLTHPNLSEALNLAVLYNQRRSNAM 747
            .|:   :|..|:..        |:.:|..:|.|...|.:..|..:.|.:
  Fly   505 TKN---DPKRVINI--------SSDVTIIDLPEYEKLQIWDNLYKPNQL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 128/597 (21%)
alpha-Est5NP_001246965.1 COesterase 7..510 CDD:278561 126/592 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.