DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and CG6414

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_001303565.1 Gene:CG6414 / 31352 FlyBaseID:FBgn0029690 Length:583 Species:Drosophila melanogaster


Alignment Length:601 Identity:156/601 - (25%)
Similarity:244/601 - (40%) Gaps:141/601 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LVLLLLTSLWPD--CCECLHGGSNTVKTKYG---LLRGIVVRSSPLVEAFLGIPYASPPVGSLRF 221
            ::||.:...|.|  ..:|||     |:..:|   :.|.:...:...:.||:|:|||.||:..|||
  Fly    12 VILLCICIQWSDGRNSQCLH-----VRLSHGGWLIGRHLTTHNGRHMRAFMGVPYAEPPLDDLRF 71

  Fly   222 MPPITPSTWKTVRSADRFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLN 286
            .||:..:.|:..|.|.:.:|:|.|..|                   .||  .::...||||||||
  Fly    72 RPPVPKAPWEGERLAIKDAPICLQRDP-------------------FRR--DMILEGSEDCLYLN 115

  Fly   287 IYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNSG-NPYDGSELAAHGNVIVVTINFRL 350
            :|.|...|        |.|    .|..:|:.||..:...|| :.:.|.:.....::::|:.||||
  Fly   116 VYTPERPR--------TNG----SLPVMVWFHGGGWQCGSGISSFYGPDFLLDHDIVLVSANFRL 168

  Fly   351 GIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVA 415
            |..|||.|...: ..||.||.|.:..|||::.|:.:|||||.|:|:.|...|.......::|..:
  Fly   169 GPLGFLSTETLD-CPGNNGLKDQLEVLHWVRANIASFGGDPNSVTVFGESAGGASVTYHMLSEKS 232

  Fly   416 SDLIQRTVLVSGSALSPWAIQKNPLFVKRR---VAEQTGCHGDMLYDDLAPCLRTKSVAELLAVK 477
            ..|:.|.:..||:..:|||...:......|   :|:..||.....:.:...|||.|...:::|..
  Fly   233 RGLLHRGIAQSGTYFNPWAQPAHKGVAAGRATKLAQIVGCGNAGEWPEKLECLRKKPAEDIVASL 297

  Fly   478 VDHPRFLVGFAPFV----------DGT--VISP--GANPLGSTTLPLGSAIVSTSGI----EYAN 524
            .|  .|:..|.|.:          ||.  .::|  .|.|.| ..|||.....:..|:    ...|
  Fly   298 YD--MFVWDFDPMIPFPPVVEPEHDGAFLTVAPRQAAKPHG-LQLPLMVGATAEEGLLKTAALLN 359

  Fly   525 FPKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRILRTFVRNNF---------------HYHLN 574
            .|:     .|...:|..:   |.|....|....|..:|..:....               |.:|.
  Fly   360 LPQ-----LLAEFKSQFE---QVLPVVLNYDHHDDSVRQTITQRIESFYFKSGHDYDKANHQNLT 416

  Fly   575 EI-----FAVLKNEYTDWEKAIRNPLSSRDA--TLQFLSDGHTASPLIKLGYMHSLRGGRAYFLH 632
            ::     |....:||      :|..:|..|.  |..:|.|...|:...::     .:|||..|. 
  Fly   417 DLISDGWFVAGIDEY------LRLRMSQEDVAPTYVYLFDHKGAASFTEI-----FKGGRNEFY- 469

  Fly   633 FKHKTIEEEYPQRSGSVRGEDVPFWLGLPMSPLFPHNY--------TTQERQIGRLMLRYLSNFA 689
                          |:...|::.:        |||...        |.::.::..|||....:||
  Fly   470 --------------GACHAEELQY--------LFPIGRELFVSAVPTQKDLELRELMLHLWVSFA 512

  Fly   690 KTGNPNQSTAKSVLPN 705
            ||||||.:.....|||
  Fly   513 KTGNPNPTNVSFHLPN 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 149/579 (26%)
CG6414NP_001303565.1 COesterase 36..567 CDD:278561 148/572 (26%)
Aes <116..>254 CDD:223730 48/150 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.