DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and cest-31

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_504692.3 Gene:cest-31 / 187304 WormBaseID:WBGene00019653 Length:541 Species:Caenorhabditis elegans


Alignment Length:554 Identity:150/554 - (27%)
Similarity:230/554 - (41%) Gaps:124/554 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NTVKTKYGLLRGIVVR-SSPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVCP-- 244
            |.:.:..|.::|.:.| .:..|..:||||||.||:|.|||..|::...|...|...::.|.||  
 Worm    15 NVLNSTCGPVQGNLYRHGNEEVHGYLGIPYAQPPIGILRFKKPVSADVWTETRDCTKYGPRCPPS 79

  Fly   245 ----QNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTG 305
                :|:.:|..      ::|                ...:||.||::.|....:|         
 Worm    80 GMLYENLQLPNT------DIP----------------DEANCLSLNVFCPQWEIKQ--------- 113

  Fly   306 EPKTKLSTVVFIHGESYDWNSGNPYDGSELAAH---GNVIVVTINFRLGIFGFLKTGGKESAQGN 367
              ..|...::||||..::.::...|....|:..   .:|||||:|:|:|..|||.| |.:|.:||
 Worm   114 --SAKHPVMIFIHGGGFELSASKDYCDYSLSGTLPLKDVIVVTVNYRVGALGFLTT-GDDSCRGN 175

  Fly   368 FGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQRTVLVSGSALSP 432
            |||.||...|.|:..::.:|||||:::||.|...|||.|::|.:||.:.||..:.:::||||..|
 Worm   176 FGLWDLTLALKWVSTHISSFGGDPKNVTLFGQSAGAVCADLLNLSPYSRDLFHKLIIMSGSAHVP 240

  Fly   433 WAI--QKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELL-------AVKVDHPRFLVGFA 488
            :||  ::|...|....|...|..|.. ..:|........:.:||       .|.:|     :.||
 Worm   241 FAIRTEENQALVCMEYARSRGFSGSG-SAELLEFFENLPIEKLLEKTGLKHTVSID-----LSFA 299

  Fly   489 PFVDGTVISPGANPLGSTT--LPLGSAIVSTSGIEYANFPKRDLIFCLTSVESYLDLSAQDLEFG 551
            |.:||.........|...|  .|:...::...|:..| |...|...|..:.:..::         
 Worm   300 PNLDGDFFPKPLEELRRETRKKPVIVGMMEDEGLITA-FADGDFTTCEENFKRRVE--------- 354

  Fly   552 FNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDW--EKAIRNPLSSRDATLQFLSD--GHTAS 612
             :|.|.|     .|.|..:...|     :.|.||::  |...|.           |.|  ||:  
 Worm   355 -SEYRGD-----VVENPENVQKN-----IMNFYTNYCDESEERK-----------LVDYIGHS-- 395

  Fly   613 PLIKLGYMHSLR-----GGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPFWLGLPMSPL------- 665
             :...|.:.|..     |...||..|....     |...|.| |..|||......|.|       
 Worm   396 -VYNAGVLLSAESLARAGNCVYFYVFDFWN-----PDGFGPV-GSIVPFKGAAHCSELRYIIGEG 453

  Fly   666 FPHNYTTQERQIGRLMLRYL----SNFAKTGNPN 695
            ....:...|:.:  .|:.|:    :||||.||||
 Worm   454 VYSKFDANEKDL--KMMEYMTTMFTNFAKYGNPN 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 150/554 (27%)
cest-31NP_504692.3 COesterase 16..522 CDD:278561 149/553 (27%)
Aes <112..>211 CDD:223730 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.