DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nlg2 and cest-34

DIOPT Version :9

Sequence 1:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_001360105.1 Gene:cest-34 / 179057 WormBaseID:WBGene00019652 Length:550 Species:Caenorhabditis elegans


Alignment Length:561 Identity:138/561 - (24%)
Similarity:218/561 - (38%) Gaps:169/561 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSPVCP-------QNIPIPPNGPEALLEV 260
            |..:||:|||.||.|.:||..|:....|...|...::.|.||       :.:.:.|:.|:     
 Worm    36 VHGYLGMPYAKPPTGEMRFAKPVPADDWTETRDCTKYGPRCPPSGQGLEKGMFVNPDEPD----- 95

  Fly   261 PRARLAQLRRLLPLLKNQSEDCLYLNIYVP-YETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDW 324
                              ..:.|.:|::|| :|           :.|.|.....:|::||..::.
 Worm    96 ------------------EANGLSVNVFVPGWE-----------SSEYKNARPVMVYVHGGGFEI 131

  Fly   325 NSGN---PYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPA 386
            :|..   .|..|......:||:||:|:||||.||..| |.|...|||||.|....|.|:::::.:
 Worm   132 SSSREFCDYSISSTLPMKDVILVTMNYRLGILGFFTT-GDEVCPGNFGLWDQTLALQWVQKHIAS 195

  Fly   387 FGGDPQSITLLGYGTGAVLANILVVSPVASDLIQRTVLVSGSALSPWAIQ--KNPLFVKRRVAEQ 449
            |||||.::||.|...|....::|.:||.:.||.|:.|.:||||:..:|::  :|...|...:..:
 Worm   196 FGGDPNNVTLFGQSAGGACVDLLTLSPHSRDLFQKVVPMSGSAMCEFAMRTAENEAHVFDDILAR 260

  Fly   450 TGCHGDMLYDDL-----APCLRTKSVAELLAVKVDHPRFLVGF---APFVDGTVISPGANPL--G 504
            .|..|....:.|     .||       :.:..|..:.....||   .|..||.......:.|  .
 Worm   261 LGFTGSGSKERLEFMRSLPC-------DKITGKTGYTYKQSGFMSLCPNYDGDFFPKPLDELRKD 318

  Fly   505 STTLPLGSAIVSTSGIEYA---NFPKRDLIFCLTSVESYLDLSAQDLEFGFNETRRDRI--LRTF 564
            ::...|.:.||...|:.:|   |.|.:|          |.||....:|..:.|...|.:  :|  
 Worm   319 ASKRILMTGIVGNEGLLFAFDRNTPYKD----------YTDLLRLKIEEDYKEDVVDDVEGIR-- 371

  Fly   565 VRNNFHYHLNEIFAVLKNEYTDWEKAIRNPLSSRDATLQFLSDG--HTASPLIKLGYMHSLRGGR 627
             :..|.|:       .||.....|:||....:      :|:.|.  ||              |.|
 Worm   372 -KEIFEYY-------TKNISEGDEEAIMRKAA------EFVGDSIFHT--------------GVR 408

  Fly   628 AYFLHFKHKTIEEEYPQRSGSVRGEDVPFWL---------GL-PMSPLFPHNYTTQERQIGRLML 682
            |              ..::.:..|::|  ||         |. |:....|:...|...:     |
 Worm   409 A--------------TAQNAAEHGDEV--WLYNFDYCNPDGFAPLKGYLPYIEPTHGME-----L 452

  Fly   683 RYL--------------------------SNFAKTGNPNQS 697
            |||                          :||||.||||::
 Worm   453 RYLFGDGIISKFEPTEEELKMLDKFTTMFANFAKYGNPNET 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 138/561 (25%)
cest-34NP_001360105.1 COesterase 15..530 CDD:365897 138/561 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.