DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rca1 and Fbxo43

DIOPT Version :9

Sequence 1:NP_477214.1 Gene:Rca1 / 33959 FlyBaseID:FBgn0017551 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001355587.1 Gene:Fbxo43 / 78803 MGIID:1926053 Length:688 Species:Mus musculus


Alignment Length:430 Identity:98/430 - (22%)
Similarity:155/430 - (36%) Gaps:140/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRKKS--PSRGSSFELEM------NESGYTSFLALHNSTAETPFLLEDAEGENCRNASNTTTFFR 66
            ||:.|  ..:||..|.||      ::||                :||..:|.. ....|....|:
Mouse   369 LRRLSTLQEQGSQSEDEMQTVHPNSDSG----------------VLESLQGSE-EKRGNLALSFK 416

  Fly    67 GL-NTPSGHQEQDLYWGKPYPRTQPQKKFSAEEEPFSMTPRLQDEHSLPKRRKKHFQSPHSSPKK 130
            .| |||:....|:|:......|:|.:.    ::|.|..    :||..:.:.::.      .:...
Mouse   417 DLSNTPALQLVQELFMKSKRKRSQQED----DQEFFED----RDEGKIARLQRV------LAGLI 467

  Fly   131 SKKLLFPHIEEPPKNRFYGGVEKLDIVAKLAQWQPALQCILRHVGAHTLDVMT--------KVSP 187
            .||:               |:|:|||:.:| |::.     |:|:.|..|:.:|        .||.
Mouse   468 GKKM---------------GIEQLDILTEL-QYRN-----LKHILAMVLESLTSESLYSAWNVSR 511

  Fly   188 AWKQAVYRSQRDLERLQNHRLKLNLTKENPHV-------PKRCSHVPKANHTVPLQTSNHS---- 241
            .|::.|.:.::...|.:.:.::|..:.:...|       .:.|.....|..:|..|....|    
Mouse   512 NWREIVAQDKKANRRRKLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQV 576

  Fly   242 -SLANSAASLMDSGNSSI-HLMDVDAGRVLREQTQRVKCPRCGRGSRVFISEAAKCGENLLSQTL 304
             :|:.....|....:||: ||..        :|.|.||..|     .:|..||.|          
Mouse   577 PTLSPWGDVLTPVASSSLTHLRS--------KQEQYVKVAR-----TLFTDEALK---------- 618

  Fly   305 PIGRTTSTFPCMTGPPLKRFLSLDLDEVRTSPQGPPYNFAECTSVICQFRFCVNCLCKSHPGERC 369
            |..|..|  |....|..||.|                    |:.:.|.|.|||.|||..|..|.|
Mouse   619 PCPRCQS--PAKYQPHKKRGL--------------------CSRLACGFDFCVLCLCAYHGSEDC 661

  Fly   370 LVTELDTPSKLMMPRERLTPPQRAQNRDPKITRKNSLKRL 409
                ....:|....::.|  |..||:       |.:||||
Mouse   662 ----RRGSAKARGSKDVL--PGSAQS-------KRNLKRL 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rca1NP_477214.1 None
Fbxo43NP_001355587.1 IBR 606..657 CDD:307574 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850022
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JDS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114765
Panther 1 1.100 - - O PTHR15493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.