DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rca1 and fbxo5

DIOPT Version :9

Sequence 1:NP_477214.1 Gene:Rca1 / 33959 FlyBaseID:FBgn0017551 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001003869.1 Gene:fbxo5 / 445392 ZFINID:ZDB-GENE-030131-4027 Length:384 Species:Danio rerio


Alignment Length:411 Identity:83/411 - (20%)
Similarity:123/411 - (29%) Gaps:175/411 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKKSPSRGSSFELEMNESGYT---SFLALHNSTAETPFL--LEDAEGENCRNASNTTTFFRGLNT 70
            ::.|....|..|:..:.||.|   .:|:||||..:...|  ||.:| |||.::            
Zfish    69 KRHSLDMASDDEVIFSGSGLTEDSGYLSLHNSQVDVDGLDSLERSE-ENCVSS------------ 120

  Fly    71 PSGHQEQDLYWGKPYPRTQPQKKFSAEEEPFSMTPRLQDEHSLPKRRKKHFQSP-----HSSPKK 130
                |..|:                             :.||.|.....:||..     ..|.||
Zfish   121 ----QSLDV-----------------------------ECHSGPCLPVLNFQEEACRELQRSYKK 152

  Fly   131 SKKLLFPHIEEPPKNRFYG---------GVEKLDIVAKLAQWQPALQCILRHVGAHTLDVM---- 182
            ::...:..:::..:|  :|         |.:.:||:.||      ::..:||:.|..|.::    
Zfish   153 NRSYDWTVVDKVAEN--FGLHNVIGGKMGRQFVDILCKL------MRKDMRHILARILGLLADCD 209

  Fly   183 ----TKVSPAWKQAVYRSQRDLERLQNHRLKLNLTKENPHVPKRCSHVPKANHTVPLQTSNHSSL 243
                ||||..|::.:.:.|..|:|.:                       ||..|           
Zfish   210 LISCTKVSRTWRKIICQDQLALQRWK-----------------------KAEKT----------- 240

  Fly   244 ANSAASLMDSGNSSIHL-MDVDAGRVLREQTQRVKCPRCGRGSRVFISEAAKCGENLLSQTLPIG 307
                  ..|||.|...| .|....||:....|.|..|                         |..
Zfish   241 ------RRDSGRSMGSLSRDFTLDRVVFSCMQTVSSP-------------------------PAH 274

  Fly   308 RTTSTFPCMTG------------------PPLKRFLSLDLDEVRTSPQGPPYNF------AECTS 348
            :.....||..|                  ..||:..||.    |.|....|..|      |.||.
Zfish   275 KAVKKPPCHMGGAQNATKSSRFQQYVEAAQSLKQHESLR----RCSRCSSPARFDAVMQRAVCTR 335

  Fly   349 VICQFRFCVNCLCKSHPGERC 369
            :.|.|.||..|....|....|
Zfish   336 ISCAFEFCTLCQSAFHDSNPC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rca1NP_477214.1 None
fbxo5NP_001003869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67
F-box-like 196..236 CDD:289689 11/62 (18%)
IBR 295..351 CDD:279784 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.