DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rca1 and Fbxo43

DIOPT Version :9

Sequence 1:NP_477214.1 Gene:Rca1 / 33959 FlyBaseID:FBgn0017551 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001012117.2 Gene:Fbxo43 / 315034 RGDID:1310225 Length:664 Species:Rattus norvegicus


Alignment Length:401 Identity:95/401 - (23%)
Similarity:132/401 - (32%) Gaps:144/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LLEDAEGENCRNASNTTTFFRGLNTPSGHQEQDLYWGKPYPRTQ--PQKKFSAEEEPFSMTPRLQ 108
            :||..:|...::...|.:|....|||:.....:|:......|.:  ..::||.|.|...:. |||
  Rat   371 VLESQQGSEEKSGDLTLSFKDLSNTPALQLVCELFMKSKRKRFEQADDQEFSEEREEGKIA-RLQ 434

  Fly   109 DEHSLPKRRKKHFQSPHSSPKKSKKLLFPHIEEPPKNRFYGGVEKLDIVAKLAQWQPALQCILRH 173
              |.|             :....||:               |:|:|||:.:| |::.     |:|
  Rat   435 --HVL-------------AGLIGKKM---------------GIERLDILTEL-QYRN-----LKH 463

  Fly   174 VGAHTLDVMT--------KVSPAWK--------------------------QAVYRSQRDLERLQ 204
            :.|..||.:|        .||..|:                          .||.|.|....||:
  Rat   464 ILAMVLDSLTAESLYSAWNVSRNWRGIVAQDKRANRRRKLFIAQLKAKAQGAAVLRVQDAATRLR 528

  Fly   205 -NHRLKLNLTKENPHVPKRCSHVPKANHTVPLQTSNHSSLANSAASLMDSGNSSIHLMDVDAGRV 268
             ..||.|...:.....|.      ..|...|.|:.....|...|:|      |..||..      
  Rat   529 LLSRLALRSVQAQAQAPN------GQNEQAPAQSPWGEVLTPVASS------SLTHLRS------ 575

  Fly   269 LREQTQRVKCPRCGRGSRVFISEAAKCGENLLSQTLPIGRTTSTFPCMTGPPLKRFLSLDLDEVR 333
              :|.|.:|..|     .:|..||.|          |..|..|  |....|..||.|        
  Rat   576 --KQEQYLKVAR-----TLFTDEALK----------PCPRCQS--PAKYQPHKKRGL-------- 613

  Fly   334 TSPQGPPYNFAECTSVICQFRFCVNCLCKSHPGERCLVTELDTPSKLMMPRERLTPPQRAQNRDP 398
                        |:.:.|.|.|||.|||..|..|.|    ....:|....|:.|  |..||:   
  Rat   614 ------------CSRLACGFDFCVLCLCAYHGSEDC----RRGSAKGRGSRDVL--PGSAQS--- 657

  Fly   399 KITRKNSLKRL 409
                |.:||||
  Rat   658 ----KRNLKRL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rca1NP_477214.1 None
Fbxo43NP_001012117.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..358
IBR 579..633 CDD:279784 24/90 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..664 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JDS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114765
Panther 1 1.100 - - O PTHR15493
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.