DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rca1 and FBXO43

DIOPT Version :9

Sequence 1:NP_477214.1 Gene:Rca1 / 33959 FlyBaseID:FBgn0017551 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_011515289.1 Gene:FBXO43 / 286151 HGNCID:28521 Length:751 Species:Homo sapiens


Alignment Length:522 Identity:107/522 - (20%)
Similarity:153/522 - (29%) Gaps:215/522 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPS---RGS----------SFELEMNESGYT----SFLALHNSTAETPFLLEDAEGENCRNA--- 58
            |||   |||          |..||.:|...:    ||..|......||.:     |:..|..   
Human   319 SPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGSFQELLQKHKGTPKV-----GDTIRKTRHL 378

  Fly    59 --SNTTTFFRGLNTPSGHQEQDLYWGKPYPRTQPQKK-----------FSAEE--------EPFS 102
              |...:..|..::.|..:|:     |.......:|:           .|::|        :..|
Human   379 GRSRRLSTLREQSSQSETEEE-----KQIVHPDSEKRAAAASAISEGQLSSDESGDLTFSLKNLS 438

  Fly   103 MTPRLQDEHSL---PKRRKKHFQSPHSSPKK-----------------SKKLLFPHIEEPPKNRF 147
            .||.||..|.|   .||::....|.|...::                 .||:             
Human   439 KTPALQLVHELFMKSKRKRLQENSGHEFLEQGDGEKIAVLQCILAGLIGKKM------------- 490

  Fly   148 YGGVEKLDIVAKLAQWQPALQCILRHVGAHTLDVMT----------------------------- 183
              |:|||||:.:|....      |:|:.|..|:.:|                             
Human   491 --GIEKLDILTELKYRN------LKHILAMVLESLTAESLCRTIRRQDPWECRGNEGEKSCGTGF 547

  Fly   184 ----------------------KVSPAWKQAVYRSQRDLERLQNHRLKLNLTKENPHVPKRCSHV 226
                                  |||..|::.|.:     ::..|.|.|..:|:..........:|
Human   548 LQDDGYGGACGKLVSLFLDSVWKVSRNWREIVVQ-----DKNANRRRKFYITQLKTDSEGAVLNV 607

  Fly   227 PKANHTVPLQTSNHSSLAN-------------SAASLMDSGNSSIHLMDVDAGRVLREQTQRVKC 278
            ..|  ...||..|.|:|.:             ..::|...|.....|.......:..:|.:.||.
Human   608 EDA--ATRLQLLNRSALRSVQAQARIPGSQREQGSTLSPWGEVLTPLASSSVTHLSSKQEEYVKV 670

  Fly   279 PRCGRGSRVFISEAAKCGENLLSQTLPIGRTTSTFPCMTGPPLKRFLSLDLDEVRTSPQGPPYNF 343
            .:     .:|..||.|          |..|..|  |....|..||.|                  
Human   671 AK-----TLFTDEALK----------PCPRCQS--PAKYQPYKKRGL------------------ 700

  Fly   344 AECTSVICQFRFCVNCLCKSHPGERCLVTELDTPSKLMMPRERLTP-PQRAQNRDPKITRKNSLK 407
              |:...|.|.|||.|||..|..|.|       ......||.|... |..||:       |.:||
Human   701 --CSRTACGFDFCVLCLCAYHGSEEC-------SRGAAKPRNRKDALPGSAQS-------KRNLK 749

  Fly   408 RL 409
            ||
Human   750 RL 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rca1NP_477214.1 None
FBXO43XP_011515289.1 IBR 669..720 CDD:279784 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JDS
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114765
Panther 1 1.100 - - O PTHR15493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.