DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rca1 and FBXO5

DIOPT Version :9

Sequence 1:NP_477214.1 Gene:Rca1 / 33959 FlyBaseID:FBgn0017551 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_036309.1 Gene:FBXO5 / 26271 HGNCID:13584 Length:447 Species:Homo sapiens


Alignment Length:415 Identity:85/415 - (20%)
Similarity:136/415 - (32%) Gaps:134/415 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LEDAEGENCRNASNTTTFFRGLNTPSGHQEQDLYWGKPYPRTQPQKKFSAEEEPFSMTPRLQDEH 111
            |.:.|.::.:...|:|.....|.|      ..||....|.....|...|..||...:.....|  
Human   115 LHNKENQHVQQTLNSTNEIEALET------SRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGD-- 171

  Fly   112 SLPKRRKKHFQSPHSSPKKSKKLLFP--HIEE------------PPK-----------------N 145
            || :......|||...|.|:   |.|  |.|:            .||                 .
Human   172 SL-QSCLLQIQSPDQYPNKN---LLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQ 232

  Fly   146 RFYG---GVEKLDIVAKLAQWQPALQCILRHVGAHTLDV----MTKVSPAWKQAVYRSQRDLERL 203
            ...|   |:|.:||:::|  ::..|:.:|..:.|...|:    ::|||..||: :....:...:|
Human   233 NIIGRKMGLECVDILSEL--FRRGLRHVLATILAQLSDMDLINVSKVSTTWKK-ILEDDKGAFQL 294

  Fly   204 QN---HRLKLNLTKENPHVPKR--------CSHVPKANHTVPLQTSNHSSLANSAASLMDSGNS- 256
            .:   .|:..|..|.:||...|        .:.|.|:.....|:....:.|:|..    |...| 
Human   295 YSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQG----DQKGST 355

  Fly   257 -SIHLMDVDAGRVLREQTQRVKCPRCGRGSRVFISEAAKCGENLLSQTLPIGRTTSTFPCMTGPP 320
             |.|....:..:.|::......|.||                          .:.:.:.|.    
Human   356 YSRHNEFSEVAKTLKKNESLKACIRC--------------------------NSPAKYDCY---- 390

  Fly   321 LKRFLSLDLDEVRTSPQGPPYNFAECTSVICQFRFCVNCLCKSHPGERCLVTELDTPSKLMMPRE 385
            |:|                    |.|....|.|.:|..|||..|..:.|      :..||:....
Human   391 LQR--------------------ATCKREGCGFDYCTKCLCNYHTTKDC------SDGKLLKASC 429

  Fly   386 RLTP-PQRAQNRDPKITRKNSLKRL 409
            ::.| |      ..|.::|| |:||
Human   430 KIGPLP------GTKKSKKN-LRRL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rca1NP_477214.1 None
FBXO5NP_036309.1 Interaction with EVI5. /evidence=ECO:0000269|PubMed:16439210 135..244 26/120 (22%)
Requires for efficient binding to CDC20. /evidence=ECO:0000250|UniProtKB:Q7TSG3 261..409 35/202 (17%)
Sufficient for interaction with RPS6KA2, Prevents association of CDC20 with RPS6KA2. /evidence=ECO:0000250|UniProtKB:Q7TSG3 261..339 17/78 (22%)
Inhibits APC ubiquitin ligase activity. /evidence=ECO:0000269|PubMed:23708605 305..447 39/208 (19%)
Competitively blocks access of APC substrates to the D-box coreceptor formed by FZR1 and ANAPC10. /evidence=ECO:0000269|PubMed:23708001 322..325 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..358 5/24 (21%)
Allows a rapid multiple mono-ubiquitination of the APC substrate, but strongly inhibits the slow ubiquitin chain elongation catalyzed by UBCH10. /evidence=ECO:0000269|PubMed:23708001 378..420 16/97 (16%)
Sufficient to suppress UBE2S activity, essential for interaction with UBE2S, competitively inhibits the rapide ubiquitin chain elongation by UBE2D1 which blocks UBE2D1 with APC, indispensable for recruitment and position of FBXO5 to the catalytic site of APC, abrogates the inhibition of ubiquitin chain assembly primarily catalyzed by UBE2S, inhibits the ubiquitination by either UBE2C or UBE2D1. /evidence=ECO:0000269|PubMed:23708001 437..447 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.