Sequence 1: | NP_001285692.1 | Gene: | sens-2 / 33957 | FlyBaseID: | FBgn0051632 | Length: | 746 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001247055.1 | Gene: | CG6808 / 41394 | FlyBaseID: | FBgn0037921 | Length: | 375 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 59/199 - (29%) |
---|---|---|---|
Similarity: | 93/199 - (46%) | Gaps: | 29/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 500 LHQFSDLYSCMKCEKMFSTPHGLEVHSRRT-------------HHGKKP---------------- 535
Fly 536 YACELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKR 600
Fly 601 FHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRR 665
Fly 666 HKET 669 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sens-2 | NP_001285692.1 | COG5048 | <504..672 | CDD:227381 | 57/195 (29%) |
C2H2 Zn finger | 509..530 | CDD:275368 | 4/33 (12%) | ||
zf-H2C2_2 | 522..545 | CDD:290200 | 7/51 (14%) | ||
C2H2 Zn finger | 538..558 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 550..575 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 566..586 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 579..603 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 594..614 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 606..631 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 622..642 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 634..657 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 650..677 | CDD:275368 | 7/20 (35%) | ||
CG6808 | NP_001247055.1 | zf-AD | 9..79 | CDD:214871 | |
C2H2 Zn finger | 229..249 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 255..277 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 257..277 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 269..293 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 285..305 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 299..321 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 341..359 | CDD:275368 | 7/17 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24381 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |