DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens-2 and CG6808

DIOPT Version :9

Sequence 1:NP_001285692.1 Gene:sens-2 / 33957 FlyBaseID:FBgn0051632 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:199 Identity:59/199 - (29%)
Similarity:93/199 - (46%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 LHQFSDLYSCMKCEKMFSTPHGLEVHSRRT-------------HHGKKP---------------- 535
            :||.....|.|..::..|..:..|.:|:.:             :|..:|                
  Fly   162 IHQEDYTISDMDLDREISDQNYSETYSQESSAATDSIQETSEDYHNLEPSADYVIDLGVACEPDK 226

  Fly   536 YACELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKR 600
            |.|::|:.|:.....|:.|..||..||..:|:.|.|.|:.:..|.||:..|:..:||.|.||.:|
  Fly   227 YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRR 291

  Fly   601 FHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRR 665
            |...|..:||..:||.|:|:.|.:|||.||.||:...|...|:..|...|.:|.|.|:.|..|..
  Fly   292 FADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQLTA 356

  Fly   666 HKET 669
            |:::
  Fly   357 HEKS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sens-2NP_001285692.1 COG5048 <504..672 CDD:227381 57/195 (29%)
C2H2 Zn finger 509..530 CDD:275368 4/33 (12%)
zf-H2C2_2 522..545 CDD:290200 7/51 (14%)
C2H2 Zn finger 538..558 CDD:275368 5/19 (26%)
zf-H2C2_2 550..575 CDD:290200 10/24 (42%)
C2H2 Zn finger 566..586 CDD:275368 7/19 (37%)
zf-H2C2_2 579..603 CDD:290200 11/23 (48%)
C2H2 Zn finger 594..614 CDD:275368 8/19 (42%)
zf-H2C2_2 606..631 CDD:290200 11/24 (46%)
C2H2 Zn finger 622..642 CDD:275368 9/19 (47%)
zf-H2C2_2 634..657 CDD:290200 6/22 (27%)
C2H2 Zn finger 650..677 CDD:275368 7/20 (35%)
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
zf-C2H2 255..277 CDD:278523 7/21 (33%)
C2H2 Zn finger 257..277 CDD:275368 7/19 (37%)
zf-H2C2_2 269..293 CDD:290200 10/23 (43%)
C2H2 Zn finger 285..305 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.