DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens-2 and ZSCAN5B

DIOPT Version :9

Sequence 1:NP_001285692.1 Gene:sens-2 / 33957 FlyBaseID:FBgn0051632 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001073925.2 Gene:ZSCAN5B / 342933 HGNCID:34246 Length:495 Species:Homo sapiens


Alignment Length:604 Identity:145/604 - (24%)
Similarity:217/604 - (35%) Gaps:172/604 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SADAALGHHQQQPAQNPNPNPNHPQPQMPPASTSPHEYAPMSAFKAV-----------LPKKRNS 152
            |.:..||:|.:      ||...|...:|   .:.|.|..|:.|.:.:           |..|...
Human    28 SPETQLGNHDR------NPETWHMNFRM---FSCPEESDPIQALRKLTELCHLWLRPDLHTKEQI 83

  Fly   153 DDASL--AFSISRLVKTEQLTAMAAAVGLKPPTPLEDNNNSISMLSKNQQMHQQHHQQSHLAQRP 215
            .|..:  .|.||   ..::|..:....|::....|||      :|..|              :||
Human    84 LDMLVMEQFMIS---MPQELQVLVKVNGVQSCKDLED------LLRNN--------------RRP 125

  Fly   216 KP---AFISASEKLRRQSRSRSRSRSRSPCSSQIDMEDADS------NHSHRSLHSRSRSRS--- 268
            |.   ..:...|.|...|   ....:.:|.|.:.|..|..|      |..|.......|.:.   
Human   126 KKWSIVNLLGKEYLMLNS---DVEMAEAPASVRDDPRDVSSQWASSVNQMHPGTGQARREQQILP 187

  Fly   269 RSRSHSRSRSHSSSSSVELEVDSPPGSPRISSPSGASASASELLITANGGGRSIGSKKSDLFSVS 333
            |..:.||.:.........::|...|.|||...                       :.:.||..  
Human   188 RVAALSRRQGEDFLLHKSIDVTGDPNSPRPKQ-----------------------TLEKDLKE-- 227

  Fly   334 ALLRRDEPP----PQRRTPRSPPLGHLTSSGLAMPFNPLEAMRQGYPPNYDAAMFQRPLFSPALP 394
               .|:|.|    |:.:.|:||              |.:.| ::|..|...|::......:|:  
Human   228 ---NREENPGLSSPEPQLPKSP--------------NLVRA-KEGKEPQKRASVENVDADTPS-- 272

  Fly   395 FFAAVAFHQGQQQQQQQQQQQSGLAAGYHPDSQENLFRLRSLMVPLQSAGQNNSSAAAAAAAAAA 459
              |.|.             ::..|.   |..::.:...|.|   |.:|...       |::.:..
Human   273 --ACVV-------------EREALT---HSGNRGDALNLSS---PKRSKPD-------ASSISQE 309

  Fly   460 AAVGVGVGVGVGVPPNGGHLGLPHSPHLHHFHHMAAKWPGLHQFSDLYSCMKCEKMFSTPHGLEV 524
            ...|....||....|....:...|||        ....|..|                 |.|.|.
Human   310 EPQGEATPVGNRESPGQAEINPVHSP--------GPAGPVSH-----------------PDGQEA 349

  Fly   525 HSRRTHHGKKPYACELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDT 589
            .:      ..|:||::|||:|.:...||.||..|..::.|:|..|.|||.:.|.|..|..:|:..
Human   350 KA------LPPFACDVCNKSFKYFSQLSIHRRSHTGDRPFQCDLCRKRFLQPSDLRVHQRVHTGE 408

  Fly   590 RPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCH 654
            |||.|:.|.|||..:|.::.|..|||||:|.||:.|.|.||...||..|.|.|:|.||:.|..|.
Human   409 RPYMCDVCQKRFAHESTLQGHKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQ 473

  Fly   655 KAFQR----KVDLRRHKET 669
            |||::    |..|:.|:||
Human   474 KAFRQLGTFKRHLKTHRET 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sens-2NP_001285692.1 COG5048 <504..672 CDD:227381 65/170 (38%)
C2H2 Zn finger 509..530 CDD:275368 3/20 (15%)
zf-H2C2_2 522..545 CDD:290200 7/22 (32%)
C2H2 Zn finger 538..558 CDD:275368 9/19 (47%)
zf-H2C2_2 550..575 CDD:290200 11/24 (46%)
C2H2 Zn finger 566..586 CDD:275368 8/19 (42%)
zf-H2C2_2 579..603 CDD:290200 11/23 (48%)
C2H2 Zn finger 594..614 CDD:275368 7/19 (37%)
zf-H2C2_2 606..631 CDD:290200 12/24 (50%)
C2H2 Zn finger 622..642 CDD:275368 9/19 (47%)
zf-H2C2_2 634..657 CDD:290200 11/22 (50%)
C2H2 Zn finger 650..677 CDD:275368 10/24 (42%)
ZSCAN5BNP_001073925.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 4/17 (24%)
SCAN 40..124 CDD:153421 20/109 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..183 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..347 32/194 (16%)
zf-C2H2 355..377 CDD:395048 10/21 (48%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..394 CDD:404364 11/23 (48%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..450 CDD:404364 12/23 (52%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-H2C2_2 453..478 CDD:404364 13/24 (54%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4275
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.