DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sens-2 and ZNF619

DIOPT Version :10

Sequence 1:NP_723223.1 Gene:sens-2 / 33957 FlyBaseID:FBgn0051632 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001138554.1 Gene:ZNF619 / 285267 HGNCID:26910 Length:616 Species:Homo sapiens


Alignment Length:230 Identity:88/230 - (38%)
Similarity:117/230 - (50%) Gaps:7/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 LHQFSDLYSCMKCEKMFSTPHGLEVHSRRTHHGKKPYACELCNKTFGHEVSLSQHRAVHNVEKVF 564
            :|.....:.|.:|.|.||..:...:| .|.|:|:|||.|:.|.|:......|.||:.:|..||.:
Human   349 IHTGEKPFKCKECGKAFSCSYDCIIH-ERIHNGEKPYECKECGKSLSSNSVLIQHQRIHTGEKPY 412

  Fly   565 ECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAF 629
            |||:|||.|.|||....|...|:..:.|.||.|.|.|...|....|..||.||||::||.|||.|
Human   413 ECKECGKAFHRSSVFLQHQRFHTGEQLYKCNECWKTFSCSSRFIVHQRIHNGEKPYECQECGKTF 477

  Fly   630 SQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQHTDLRVHLGKVDFMSAAAAAAASA 694
            ||...|:.|.|.|||.||:.||.|.|||:......:|:: .||  |..|.....:||.......|
Human   478 SQKITLVQHQRVHTGEKPYECKECGKAFRWNASFIQHQK-WHT--RKKLINGTGLSAVKPYCPCA 539

  Fly   695 ELSAAAAAAAAAGGSVPGGGPPGSQGANAVGSAPN 729
            .||........:..:.|  |||.| .::||...|:
Human   540 ILSPLPPQHTCSALAPP--GPPLS-SSHAVVLPPS 571

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sens-2NP_723223.1 COG5048 <504..672 CDD:227381 70/167 (42%)
C2H2 Zn finger 509..530 CDD:275368 7/20 (35%)
SUF4-like 534..>589 CDD:411020 24/54 (44%)
C2H2 Zn finger 538..558 CDD:411020 6/19 (32%)
C2H2 Zn finger 538..558 CDD:275368 6/19 (32%)
C2H2 Zn finger 566..586 CDD:411020 10/19 (53%)
C2H2 Zn finger 566..586 CDD:275368 10/19 (53%)
C2H2 Zn finger 594..614 CDD:275368 7/19 (37%)
zf-H2C2_2 606..631 CDD:463886 13/24 (54%)
C2H2 Zn finger 622..642 CDD:275368 11/19 (58%)
C2H2 Zn finger 650..677 CDD:275368 10/26 (38%)
ZNF619NP_001138554.1 KRAB 20..120 CDD:214630
C2H2 Zn finger 246..266 CDD:275368
COG5048 <256..414 CDD:227381 22/65 (34%)
C2H2 Zn finger 274..294 CDD:275368
C2H2 Zn finger 302..322 CDD:275368