DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17375 and CG31248

DIOPT Version :9

Sequence 1:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster


Alignment Length:144 Identity:27/144 - (18%)
Similarity:46/144 - (31%) Gaps:47/144 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VFFPSSLP--------RNLFQQIIMMKKELIDATKANMGISTYDALFVHEIAFPDELYFNRDFLS 159
            :.|.::||        |:|.|..|.:.|||.:    ..|:...|          |:|...|.   
  Fly   147 LMFLATLPSHERLGLGRSLSQFTIELTKELAE----GKGLEDID----------DKLRSKRP--- 194

  Fly   160 TIFDVFGFVAQHMHMPRVSFIALSSVDQEAASLIDYEEIGRTIYSIYKVGNTRPFDILRELDEMY 224
                           ..|:.:..|...|:.....|::.|....||.::....|       .||..
  Fly   195 ---------------AAVTALWTSRFSQKVGKATDFKVINTVSYSEFEYKGKR-------FDERI 237

  Fly   225 ALLFELAVSPVLKY 238
            .|:.:.....:.|:
  Fly   238 NLIHKFCEHVIYKF 251



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.