DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17375 and AANAT1

DIOPT Version :9

Sequence 1:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster


Alignment Length:130 Identity:23/130 - (17%)
Similarity:51/130 - (39%) Gaps:42/130 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SFLKSLVY--ESLGLF-DLPDMKQTYSWYVRHILRNECSVMMI------------------SEDE 83
            :.||:..:  |.|..| ||.:.|:...:.::. |.:.||...:                  |.|:
  Fly    72 AMLKTFFFKDEPLNTFLDLGECKELEKYSLKP-LPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDD 135

  Fly    84 TQIRA------------VGLLEWMTEEWHSWVFFPSSLPRNLFQQIIMMKKEL-IDATKANMGIS 135
            ...:|            :.|::.:.|:::.:..:|.       :::|:..|.| :|.....:||:
  Fly   136 VPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPD-------EELILDGKILSVDTNYRGLGIA 193

  Fly   136  135
              Fly   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17375NP_609076.3 None
AANAT1NP_995934.1 RimI <168..235 CDD:223532 7/33 (21%)
NAT_SF <183..227 CDD:302625 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.