DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17375 and CG31493

DIOPT Version :9

Sequence 1:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:282 Identity:51/282 - (18%)
Similarity:98/282 - (34%) Gaps:98/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DVFEG-MQIVDINSKYYDMVIEFMWSNSF----------LKS--LVYESLGLFDLPDMKQTYSWY 65
            ::||| .:::.:....||.|.|.:.:.|.          ||.  |....||......:.:..|:.
  Fly     6 EIFEGEFEVLRVTPPLYDEVEELLVNISINYEFGCVIAKLKDSPLAIAELGKLIRHIISRGISFA 70

  Fly    66 VRH-----ILRNECSVMMISEDET-------QIRAVGLLEWMTEEWHSWVFFPSSLPRNLFQQII 118
            :||     |:....:::..::.:|       ||::..::::|                       
  Fly    71 IRHVESGRIVAAIANIIFNTKRKTSYYDICAQIKSPNMIKYM----------------------- 112

  Fly   119 MMKKELIDATKANMGI-------STYDALFVHEIAFPDELYFNRDFLSTI--------------- 161
                ||.||..|:..:       ||.|..::  ...|:   |.|..|..|               
  Fly   113 ----ELWDAVDASFNVNEHCQVDSTGDVEYM--ATLPE---FRRRGLGHILCQQSIQFASLLAQR 168

  Fly   162 ---FDVFGFVAQHMHMPRVSFIALSSVDQEAASLIDYEEIG-RTIYSIYKVGNTRPFDILREL-- 220
               .::...:.:.|.:.|..  |:.::....:|.|...::| :|::..:       |..||.|  
  Fly   169 KLPLEILNQLPEEMRIERPQ--AIVAITTSQSSQIMGRQLGMKTMHKWH-------FSELRSLCG 224

  Fly   221 ----DEMYALLFELAVSPVLKY 238
                ....|..||.|...|:|:
  Fly   225 AMAESNGAAQAFEYAELQVVKF 246



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.