powered by:
Protein Alignment CG17375 and R05H10.1
DIOPT Version :9
Sequence 1: | NP_609076.3 |
Gene: | CG17375 / 33956 |
FlyBaseID: | FBgn0031861 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497076.1 |
Gene: | R05H10.1 / 175144 |
WormBaseID: | WBGene00011042 |
Length: | 250 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 14/59 - (23%) |
Similarity: | 20/59 - (33%) |
Gaps: | 23/59 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 205 IYKVGNTRPFD-ILRELDEMYALLFELAVSPVLKYIEMPGFEEFHEALDARLAKEAAEK 262
||:......|| ||:.|.|.: :||....|.:|.|.|:
Worm 6 IYRTAEKSDFDRILKFLAEHF----------------------YHEEPSIRASKIALEE 42
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR20905 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.