DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17377 and KRTAP5-3

DIOPT Version :9

Sequence 1:NP_723220.2 Gene:CG17377 / 33954 FlyBaseID:FBgn0031859 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001012726.1 Gene:KRTAP5-3 / 387266 HGNCID:23598 Length:238 Species:Homo sapiens


Alignment Length:252 Identity:70/252 - (27%)
Similarity:78/252 - (30%) Gaps:96/252 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CDGCGSLEPRGCRSRELRCGIMYTTCDCVKRNGLQDKCPRSACQGRPACLCFPFPTCGPAAFPLR 66
            |.|||| ...||.|....||   :.| ||     ...|.:..|...|||.|....:||.:     
Human    14 CGGCGS-SCGGCGSGYGGCG---SGC-CV-----PVCCCKPVCCCVPACSCSSCGSCGGS----- 63

  Fly    67 YANMMMGV----NNKRMRCAATGAPNGGAG---------------CGGRVA---------GGC-- 101
                 .||    ...:..|.:.|...||.|               |||...         |||  
Human    64 -----KGVCGSCGGCKGGCGSCGGSKGGCGSSCCVPVCCSSSCGSCGGSKGVCGFRGGSKGGCGS 123

  Fly   102 CGCG------PCCCN--------VSPCCGPH------SPPCCGSHSL--PCC---GPHSPPCGAP 141
            |||.      ||||:        .|.||.|.      ..|||...|.  |||   |..|..|.:.
Human   124 CGCSQCSCYKPCCCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSS 188

  Fly   142 SPIPCSSAPGMCCPPLPEGGIPDPRVWNYYNAPVTYPCKSGPGPSTCPPVCPSACPS 198
            ...||.| ...||.|.                    .|.||.|.|.|...|...|.|
Human   189 CCKPCCS-QSSCCKPC--------------------CCSSGCGSSCCQSSCCKPCSS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17377NP_723220.2 None
KRTAP5-3NP_001012726.1 11 X 4 AA repeats of C-C-X-P 35..231 60/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.