Sequence 1: | NP_723220.2 | Gene: | CG17377 / 33954 | FlyBaseID: | FBgn0031859 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012726.1 | Gene: | KRTAP5-3 / 387266 | HGNCID: | 23598 | Length: | 238 | Species: | Homo sapiens |
Alignment Length: | 252 | Identity: | 70/252 - (27%) |
---|---|---|---|
Similarity: | 78/252 - (30%) | Gaps: | 96/252 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 CDGCGSLEPRGCRSRELRCGIMYTTCDCVKRNGLQDKCPRSACQGRPACLCFPFPTCGPAAFPLR 66
Fly 67 YANMMMGV----NNKRMRCAATGAPNGGAG---------------CGGRVA---------GGC-- 101
Fly 102 CGCG------PCCCN--------VSPCCGPH------SPPCCGSHSL--PCC---GPHSPPCGAP 141
Fly 142 SPIPCSSAPGMCCPPLPEGGIPDPRVWNYYNAPVTYPCKSGPGPSTCPPVCPSACPS 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17377 | NP_723220.2 | None | |||
KRTAP5-3 | NP_001012726.1 | 11 X 4 AA repeats of C-C-X-P | 35..231 | 60/227 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |