Sequence 1: | NP_723220.2 | Gene: | CG17377 / 33954 | FlyBaseID: | FBgn0031859 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032911.1 | Gene: | Krtap5-5 / 114666 | MGIID: | 2149673 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 62/211 - (29%) |
---|---|---|---|
Similarity: | 71/211 - (33%) | Gaps: | 69/211 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 CDGCGSLEPRGCRSRELRCGIMYTTCDCVKRNGLQDKCPRSACQGRPACLCFPFPTCGPAAFPLR 66
Fly 67 YANMMMGVNNKRMRCAATGAPNGGAG-CGGRVAGGCCGCGPCCCNVSPCCGPHSPPCCGSHSL-- 128
Fly 129 PCCGPHSPPCGAP-------SPIPCSSAPGMCCPPLPEGGIPDPRVWNYYNAPVTYPCKSGPGPS 186
Fly 187 TC------PPVCPSAC 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17377 | NP_723220.2 | None | |||
Krtap5-5 | NP_001032911.1 | 15 X 4 AA repeats of C-C-X-P. /evidence=ECO:0000255 | 35..234 | 52/174 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |