DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17377 and Krtap5-5

DIOPT Version :9

Sequence 1:NP_723220.2 Gene:CG17377 / 33954 FlyBaseID:FBgn0031859 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001032911.1 Gene:Krtap5-5 / 114666 MGIID:2149673 Length:241 Species:Mus musculus


Alignment Length:211 Identity:62/211 - (29%)
Similarity:71/211 - (33%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CDGCGSLEPRGCRSRELRCGIMYTTCDCVKRNGLQDKCPRSACQGRPACLCFPFPTCGPAAFPLR 66
            |.|||.  ..||.|   .||...::|           |.:..|..:|.|.|.|..:|........
Mouse    14 CGGCGC--SGGCGS---SCGGCGSSC-----------CCKPVCCCKPVCCCVPACSCSSCGGCKG 62

  Fly    67 YANMMMGVNNKRMRCAATGAPNGGAG-CGGRVAGGCCGCGPCCCNVSPCCGPHSPPCCGSHSL-- 128
            ......|....   |.:.|...||.| |||  .|.|.||.|.||. |.||    .|||...|.  
Mouse    63 GCGSCGGCKGS---CGSCGGCKGGCGSCGG--CGSCGGCKPSCCQ-SSCC----KPCCCQSSCCK 117

  Fly   129 PCCGPHSPPCGAP-------SPIPCSSAPGMCCPPLPEGGIPDPRVWNYYNAPVTYPCKSGPGPS 186
            |||   |..||:.       .|..|.|:   ||.|.                     |.||.|.|
Mouse   118 PCC---SSGCGSSCCQSSCCKPCCCQSS---CCKPC---------------------CSSGCGSS 155

  Fly   187 TC------PPVCPSAC 196
            .|      |..|.|:|
Mouse   156 CCQSSCCKPCCCQSSC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17377NP_723220.2 None
Krtap5-5NP_001032911.1 15 X 4 AA repeats of C-C-X-P. /evidence=ECO:0000255 35..234 52/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.