DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and SHBG

DIOPT Version :9

Sequence 1:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001031.2 Gene:SHBG / 6462 HGNCID:10839 Length:402 Species:Homo sapiens


Alignment Length:146 Identity:34/146 - (23%)
Similarity:52/146 - (35%) Gaps:38/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DSWA---KIGIFYVAFYGVLAALVAICMWAFFQTLDPRIPKW----TLDRSLI---GTNPGLGFR 100
            :.||   .:|:...|..|.|.||..           |..|.|    ..|:.::   |:.|||   
Human   246 EPWAFSLDLGLKQAAGSGHLLALGT-----------PENPSWLSLHLQDQKVVLSSGSGPGL--- 296

  Fly   101 PLPPVDNVE-------STLIWYKGTQHENYKHWTDSLDDFLAVYKVP------GLTPGRGQNIYN 152
            .||.|..:.       |.::..:|::.:........|...|.::..|      |..||...:...
Human   297 DLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSF 361

  Fly   153 CDYNQPPPKGQVCDVD 168
            | .|....:||..|||
Human   362 C-LNGLWAQGQRLDVD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 34/146 (23%)
SHBGNP_001031.2 Laminin_G_1 75..205 CDD:278483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.