DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and ATP4B

DIOPT Version :9

Sequence 1:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_000696.1 Gene:ATP4B / 496 HGNCID:820 Length:291 Species:Homo sapiens


Alignment Length:341 Identity:80/341 - (23%)
Similarity:128/341 - (37%) Gaps:90/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDGFQQYYSRPPERPKKKSLKQMVYDSEDNSYFGRSMDSWAKIGIFYVAFYGVLAALVAICMWAF 73
            ::.||:|...|                :.....||::..|..|.::|||||.|:..|.|:|::..
Human    14 MEEFQRYCWNP----------------DTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVL 62

  Fly    74 FQTLDPRIPKWTLDRSLIGTNPGLGFRP-------LPPVDNVESTLIWYKGTQHENYKHWTDSLD 131
            .||:||..|.:. |:.   .:||:..||       |..|.||.....|...||         :|.
Human    63 MQTVDPYTPDYQ-DQL---RSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQ---------TLH 114

  Fly   132 DFLAVYKVPGLTPGRGQNIYNC---------DYNQPPPKGQVCDVDIKTWSPCT--KENNYSYHK 185
            .|||     |.:|...::..||         .:..|......|.........|:  .:.|:.:.:
Human   115 AFLA-----GYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEE 174

  Fly   186 SAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQE 250
            ..||..:|:|:|..::|     ||.....:..:.        ..||.:|.         .|..  
Human   175 GKPCFIIKMNRIVKFLP-----SNGSAPRVDCAF--------LDQPRELG---------QPLQ-- 215

  Fly   251 NIGAVNYLPIRG-FPGYFYPYQNSEG---YLSPLVAVHFQRPKRGIIINVECRAWARNII----H 307
                |.|.|..| |..:::||...:.   |.:||||.......|...:.:.|:..|.::.    |
Human   216 ----VKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPH 276

  Fly   308 DRKERIGSVHYELLID 323
            |..|  |.|.::|.|:
Human   277 DPYE--GKVEFKLKIE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 73/318 (23%)
ATP4BNP_000696.1 Na_K_ATPase_bet 2..291 CDD:273446 80/341 (23%)
immunoglobulin-like 194..291 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.