DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and CG5250

DIOPT Version :9

Sequence 1:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster


Alignment Length:279 Identity:62/279 - (22%)
Similarity:102/279 - (36%) Gaps:70/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KIGIFYVAFYGVLA------ALVAICMWAFFQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNV 108
            |:.::::.|:.||.      |||.|....:        |    ||......|||...|...|.: 
  Fly    50 KLLLYFIGFFFVLGVFTTGLALVMIANHIY--------P----DRPGCKKFPGLATAPGHHVGD- 101

  Fly   109 ESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWS 173
            :..::|    ...|.|...:.....:...|..||              :.|.:...|::|     
  Fly   102 QKQIMW----SPNNIKDVANIQRAIMRTVKRYGL--------------EGPKRLMGCNID----- 143

  Fly   174 PCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIW 238
                 :::.|....|||.:|:.:..|:....|:.:..||...|..|..|:  |.....|:.|.||
  Fly   144 -----DSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYV--VGLGSEERFNRIW 201

  Fly   239 VSCEGENP-ADQENIGAVNYLPIRGF-------PGYFY---------PYQNSEGYLSPLVAVHFQ 286
            |||:...| .|.:    .:|.|:|.|       .|..:         |....:..|..:::|...
  Fly   202 VSCQVIEPRVDIQ----FDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKEDPRLRRIISVRLS 262

  Fly   287 RPKRGIIINVECRAWARNI 305
            .......|.:.|:|||:||
  Fly   263 NIPINEDIQIHCKAWAKNI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 62/279 (22%)
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.