DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and GABA-B-R1

DIOPT Version :9

Sequence 1:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:37/120 - (30%) Gaps:56/120 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SLDDFLAVYKVPGL---------------TPGRGQNI-YNCDYNQPPPK------GQVCDV---D 168
            :|||   |.|.|.|               .||.|.:: ||..||:|...      ..||..   .
  Fly    60 ALDD---VNKQPNLLPGFKLILHSNDSECEPGLGASVMYNLLYNKPQKLMLLAGCSTVCTTVAEA 121

  Fly   169 IKTW----------SPCTKENNYSYHKSAPCIF-------------LKLNKIYGW 200
            .|.|          ||...:     .|..|.:|             :||.|.:||
  Fly   122 AKMWNLIVLCYGASSPALSD-----RKRFPTLFRTHPSATVHNPTRIKLMKKFGW 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 29/120 (24%)
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361 29/120 (24%)
ANF_receptor 52..415 CDD:279440 29/120 (24%)
7tm_3 476..730 CDD:278433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.