DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and Shbg

DIOPT Version :9

Sequence 1:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus


Alignment Length:125 Identity:25/125 - (20%)
Similarity:43/125 - (34%) Gaps:38/125 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SRPPERPKKKSLKQMVYDSEDNSYFG--RSMDSWAKIGI----FYVAFYGVLAALVAICMWAFFQ 75
            |:|     ..|.:...:|.|...::|  .:.|.|..:|:    ..:..:.         :||   
  Rat   110 SKP-----SSSFEFRTWDPEGVIFYGDTNTEDDWFMLGLRDGQLEIQLHN---------LWA--- 157

  Fly    76 TLDPRIPKWTLDRSLIGTNPGLGFRPLPPVD---NVESTLIWYKGTQHENYKHWTDSLDD 132
                        |..:|..|.|......||:   |.:|.|:|..|.:....:..:.||.|
  Rat   158 ------------RLTVGFGPRLNDGRWHPVELKMNGDSLLLWVDGKEMLCLRQVSASLAD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 23/118 (19%)
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.