DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv2 and Atp1b2

DIOPT Version :10

Sequence 1:NP_477168.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_038201.1 Gene:Atp1b2 / 11932 MGIID:88109 Length:290 Species:Mus musculus


Alignment Length:163 Identity:34/163 - (20%)
Similarity:59/163 - (36%) Gaps:45/163 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYIGSNVTAAGMTFTTALNTLA-----ADRSNNVNGTFAPVYQAITAMRTL-------------- 51
            |.:..:|:.....||..:|.|.     .|....|..:|:..:..:.|..:.              
Mouse   243 LTLKGSVSGIKFLFTPDVNELLDPQTWLDAGAQVFFSFSLAFGGLIAFSSYNSVHNNCEQDAVII 307

  Fly    52 -LQTGFTDQFAAL---SKQGPFITKQFNDAFR----SILDRLTLFTGALDRMKTGVTSARDAAGN 108
             :..|.|..:||:   |..|...|::|:|...    |:|:...|..|::            ..||
Mouse   308 SIINGMTSIYAAIVIYSIIGFRATERFDDCLNGNILSLLNAFDLPEGSI------------IEGN 360

  Fly   109 PPNGISSDNLAR-----YVPLKLSIDLQDALSR 136
            ....|...|::|     .:.|| :.|:|..||:
Mouse   361 YTEAIQQLNISRPDIIQELQLK-TCDMQTFLSQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv2NP_477168.1 Na_K-ATPase 18..317 CDD:459748 32/151 (21%)
Atp1b2NP_038201.1 Na_K_ATPase_bet 2..289 CDD:273446 9/45 (20%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 9/46 (20%)

Return to query results.
Submit another query.