powered by:
Protein Alignment nrv1 and SHBG
DIOPT Version :9
Sequence 1: | NP_001260163.1 |
Gene: | nrv1 / 33952 |
FlyBaseID: | FBgn0015776 |
Length: | 309 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001031.2 |
Gene: | SHBG / 6462 |
HGNCID: | 10839 |
Length: | 402 |
Species: | Homo sapiens |
Alignment Length: | 58 |
Identity: | 16/58 - (27%) |
Similarity: | 22/58 - (37%) |
Gaps: | 12/58 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 LLSTISDTEPKW---KLQDSLI----GTNPGLGF-----RPLSEQTERGSVIAFDGKK 114
||:..:...|.| .|||..: |:.|||.. .||..:.....|:...|.|
Human 265 LLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSK 322
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
nrv1 | NP_001260163.1 |
Na_K-ATPase |
20..303 |
CDD:278704 |
16/58 (28%) |
SHBG | NP_001031.2 |
Laminin_G_1 |
75..205 |
CDD:278483 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3927 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.