DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and ATP1B3

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001670.1 Gene:ATP1B3 / 483 HGNCID:806 Length:279 Species:Homo sapiens


Alignment Length:326 Identity:100/326 - (30%)
Similarity:145/326 - (44%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKNNGKGAKGEFEFPQPAKKQTFSE---MIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALF 62
            |:||..|           :..|:.:|   .||||..|.|.|||.|||..:||||.:||..|||||
Human     1 MTKNEKK-----------SLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALF 54

  Fly    63 TICMQGLLSTISDTEPKWKLQDSLIGTNPGLGF--RPLS--EQTERGSVIAFDGKKPAESDYWIE 123
            :..|..:|.|::|..||::  |.:  .:|||..  :|::  |.|       |....|.....:||
Human    55 SFTMWVMLQTLNDEVPKYR--DQI--PSPGLMVFPKPVTALEYT-------FSRSDPTSYAGYIE 108

  Fly   124 LIDDFLRDYNHTEGRDMKHCGFGQVLE---PTDV-CVVNTDLFGGCSKAN--NYGYKTNQPCIFL 182
            .:..||:.|...|.:::..|..|.:.|   |..| |.....|...||..|  ::||....|||.:
Human   109 DLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILV 173

  Fly   183 KLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGF 247
            |:|:|.|..||...:                         :.|   :.|: |:..|:..:|..|.
Human   174 KMNRIIGLKPEGVPR-------------------------IDC---VSKN-EDIPNVAVYPHNGM 209

  Fly   248 PSY-YYPFLNQP---GYLSPLVAVQFNSPPK--GQMLDVECRAWAKNIQYSGSVRDR-KGSVTFQ 305
            ... |:|:..:.   |||.||||||.:..|.  |:.:.|||:........|...||: .|.|.|:
Human   210 IDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFK 274

  Fly   306 I 306
            |
Human   275 I 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 93/302 (31%)
ATP1B3NP_001670.1 Na_K_ATPase_bet 1..279 CDD:273446 100/326 (31%)
immunoglobulin-like. /evidence=ECO:0000250 186..279 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4783
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4506
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.