DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and ATP1B2

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001669.3 Gene:ATP1B2 / 482 HGNCID:805 Length:290 Species:Homo sapiens


Alignment Length:320 Identity:98/320 - (30%)
Similarity:148/320 - (46%) Gaps:62/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QPAKK------QTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISD 75
            |..||      :.:.|.::||:...|.||||.||:.:||||.:||..|.|:||:.|..:|.|:||
Human     4 QKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSD 68

  Fly    76 TEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYW---IELIDDFLRDYNHT-- 135
            ..||:  ||.|  ..|||..||   :||...||.    ..::::.|   ::.::.||..||.:  
Human    69 HTPKY--QDRL--ATPGLMIRP---KTENLDVIV----NVSDTESWDQHVQKLNKFLEPYNDSIQ 122

  Fly   136 --------EGRDMKHCGFGQVLEPTDVCVVNTDLFGGCS---KANNYGYKTNQPCIFLKLNKIFG 189
                    .||..:....|.:..|...|..|....|.||   .:.:|||.|.|||:|:|:|::..
Human   123 AQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVIN 187

  Fly   190 WIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-FPSYYYP 253
            :.                       ....|.:.|:|.|...:|.||..|...||:.| ....|:|
Human   188 FY-----------------------AGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFP 229

  Fly   254 FLNQP---GYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDR-KGSVTFQILLD 309
            :..:.   .|..|||||:|.:......::||||..|.||. :...||: .|.|.|::.::
Human   230 YYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIA-TDDERDKFAGRVAFKLRIN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 95/309 (31%)
ATP1B2NP_001669.3 Na_K_ATPase_bet 2..289 CDD:273446 98/320 (31%)
immunoglobulin-like 193..290 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4783
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36075
Inparanoid 1 1.050 139 1.000 Inparanoid score I4506
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.