DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and Atp1b3

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_037045.1 Gene:Atp1b3 / 25390 RGDID:2172 Length:279 Species:Rattus norvegicus


Alignment Length:323 Identity:95/323 - (29%)
Similarity:146/323 - (45%) Gaps:86/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKQTFSE-------MIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTE 77
            :|::|.:       .||||..|.|.|||.|||..:||||.:||..||||||..|..:|.|::|..
  Rat     5 EKKSFHQSLAEWKLFIYNPTSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLNDEV 69

  Fly    78 PKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDY------------WIELIDDFLR 130
            ||::  |.:  .:|||...|               |.|...||            ::|.:.:||:
  Rat    70 PKYR--DQI--PSPGLMVFP---------------KPPTALDYTYSMSDPHTYKKFVEDLKNFLK 115

  Fly   131 DYNHTEGRDMKHCGFGQVL--EPTD--VCVVNTDLFGGCSKAN--NYGYKTNQPCIFLKLNKIFG 189
            .|:..|.:::..|..|.:.  |..|  .|.....|...||..|  |:||...|||:.:|:|:|..
  Rat   116 PYSVEEQKNLTDCPGGALFHQEGPDYSACQFPVSLLQECSGVNDSNFGYSKGQPCVLVKMNRIIE 180

  Fly   190 WIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG------FP 248
            .:|:       ..|                  :::|   :.|: ||..||..:|..|      ||
  Rat   181 LVPD-------GAP------------------YITC---ITKE-ENIANIVTYPDDGLIDLKYFP 216

  Fly   249 SYYYPFLNQPGYLSPLVAVQ--FNSPPKGQMLDVECRA-WAKNIQYSGSVRDR-KGSVTFQIL 307
              ||......||..||||||  |.:....:.:.:||:. ..:|:: :.:.||: .|.|:|:::
  Rat   217 --YYGKKRHVGYRQPLVAVQVIFGADATKKEVTIECQIDGTRNLK-NKNERDKFLGRVSFKVI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 93/317 (29%)
Atp1b3NP_037045.1 Na_K_ATPase_bet 1..279 CDD:273446 95/323 (29%)
immunoglobulin-like. /evidence=ECO:0000250 186..279 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9102
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.