DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and Shbg

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus


Alignment Length:156 Identity:39/156 - (25%)
Similarity:57/156 - (36%) Gaps:52/156 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAKGEF---EFPQP-AKKQTFS-EMIYNPQEGTFFGR-----TGKSWSQLLLFYTIFYIVLAALF 62
            |...||   :.||| ....||| |:.:...:|.  ||     ||.:.|.|.|......:||:   
  Rat   273 GTHAEFSLQDIPQPHTDPWTFSLELGFKLVDGA--GRLLTLGTGTNSSWLTLHLQDQTVVLS--- 332

  Fly    63 TICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDD 127
                       |:.|||..|..::     ||   ||..:.:...|....|.|       :|::..
  Rat   333 -----------SEAEPKLALPLAV-----GL---PLQLKLDVFKVALSQGPK-------MEVLST 371

  Fly   128 FL-------RDYNHTEGRDMKHCGFG 146
            .|       |.::|.:|    |...|
  Rat   372 SLLRLASLWRLWSHPQG----HLSLG 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 33/140 (24%)
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.