DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and Atp4b

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_036642.2 Gene:Atp4b / 24217 RGDID:2178 Length:294 Species:Rattus norvegicus


Alignment Length:305 Identity:80/305 - (26%)
Similarity:133/305 - (43%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTEPKWKLQDSLIG 88
            |.:..:||..|...|||...|..:.|:|..||:|:..||.:|:..|:.||....|.:  ||.|  
  Rat    17 FRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIDPYTPDY--QDQL-- 77

  Fly    89 TNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIEL---IDDFLRDYNHTEGRDMKHCG-----F 145
            .:||:..|| ....|||..|:::   .:|:..|..|   :..||..|.....:|..:|.     |
  Rat    78 KSPGVTLRP-DVYGERGLQISYN---ISENSSWAGLTHTLHSFLAGYTPASQQDSINCSSEKYFF 138

  Fly   146 GQVLEPTD----VCVVNTDLFGGCSKA--NNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKD--M 202
            .:.....:    .|....|:...||..  .::|::..:||..:|:|:|..::|........|  .
  Rat   139 QETFSAPNHTKFSCKFTADMLQNCSGLVDPSFGFEEGKPCFIIKMNRIVKFLPSNNTAPRVDCTF 203

  Fly   203 PDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-FPSYYYPFLN---QPGYLSP 263
            .||.:|.                    .||.|..| ::|:|..| |..:|:|:..   ||.|.:|
  Rat   204 QDDPQKP--------------------RKDIEPLQ-VQYYPPNGTFSLHYFPYYGKKAQPHYSNP 247

  Fly   264 LVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILL 308
            |||.:|.:.||...:.:.|:..|.::.:.......:|.|.|::.:
  Rat   248 LVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKLTI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 78/298 (26%)
Atp4bNP_036642.2 Na_K_ATPase_bet 2..294 CDD:273446 80/305 (26%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm9102
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.