DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and Shbg

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_035497.1 Gene:Shbg / 20415 MGIID:98295 Length:403 Species:Mus musculus


Alignment Length:164 Identity:36/164 - (21%)
Similarity:55/164 - (33%) Gaps:72/164 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GAKGEF---EFPQP-AKKQTFS-EMIYNPQEGTFFGR-----TGKSWSQLLLFYTIFYIVLAALF 62
            |...||   :.||| |...||| |:.:...:|:  |:     ||.:.|.|.:......:||:   
Mouse   231 GTHAEFSLQDIPQPHADPWTFSLELGFKLVDGS--GQLLALGTGTNSSWLNIHLQNQSVVLS--- 290

  Fly    63 TICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKK------------- 114
                       |:.|||     .::..:.||   ||....:|..|:...|.|             
Mouse   291 -----------SEAEPK-----VVLPLDVGL---PLQLTLDRVKVVLSQGPKMEVLSMSLLRPAS 336

  Fly   115 -----------------PAE--------SDYWIE 123
                             |.|        ||:|::
Mouse   337 LWRLWSHPQGHLSLGALPGESSSASFCLSDFWVQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 29/148 (20%)
ShbgNP_035497.1 Laminin_G_1 76..206 CDD:333802
LamG 225..369 CDD:389952 35/161 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.