DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and Atp1b3

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_031528.1 Gene:Atp1b3 / 11933 MGIID:107788 Length:278 Species:Mus musculus


Alignment Length:310 Identity:95/310 - (30%)
Similarity:140/310 - (45%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKQTFSE-------MIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTISDTE 77
            :|::|.:       .||||..|.|.|||.|||..:||||.:||..||||||..|..:|.|::|..
Mouse     5 EKKSFHQSLAEWKLFIYNPSSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWAMLQTLNDEV 69

  Fly    78 PKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKH 142
            ||::  |.:  .:|||...|   :.:......|...:|......:|.::.||:.|:..|.:::..
Mouse    70 PKYR--DQI--PSPGLMVFP---KPQTALEYTFSMSEPQTYKKLVEDLESFLKPYSVEEQKNLTS 127

  Fly   143 CGFGQ--VLEPTD--VCVVNTDLFGGCSKAN--NYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKD 201
            |..|.  :....|  .|.....|...||...  |:||...||||.:|:|:|...||:.|.:    
Mouse   128 CPDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPDGYPQ---- 188

  Fly   202 MPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG------FPSYYYPFLNQPGY 260
                                 :||     ..||....|..:|..|      ||  ||......||
Mouse   189 ---------------------ISC-----LPKEENATIATYPEFGVLDLKYFP--YYGKKRHVGY 225

  Fly   261 LSPLVAVQ--FNSPPKGQMLDVECR-AWAKNIQYSGSVRDR-KGSVTFQI 306
            ..||||||  |:|....:.:.|||. |..:|:: :.:.||: .|.|:|::
Mouse   226 RQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLK-NKNERDKFLGRVSFKV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 93/305 (30%)
Atp1b3NP_031528.1 Na_K-ATPase 1..278 CDD:298651 95/310 (31%)
immunoglobulin-like. /evidence=ECO:0000250 186..278 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm8856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4478
SonicParanoid 1 1.000 - - X254
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.