DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nrv1 and atp1b4

DIOPT Version :9

Sequence 1:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_002664470.2 Gene:atp1b4 / 100037383 ZFINID:ZDB-GENE-070412-1 Length:347 Species:Danio rerio


Alignment Length:313 Identity:92/313 - (29%)
Similarity:138/313 - (44%) Gaps:52/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PQPAKKQTFSEMI-------YNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLSTI 73
            |:|..|:|..|.|       :|.:...|.||:|||||.:||||...||.|||:|..||..|:.:|
Zfish    61 PKPKPKRTLHEKIDDLKTYLWNAETKEFMGRSGKSWSLILLFYAALYIFLAAMFAGCMCCLMWSI 125

  Fly    74 SDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNH-TEG 137
            |...|.:  .|.::  .||:...| ...|..|..|||:....:....:.:.::..|:.|:. .:.
Zfish   126 SPYAPTY--NDRVM--PPGMTMFP-HVDTAHGFDIAFNASDRSSWRRYAKTLEAHLKPYDDGLQS 185

  Fly   138 RDMKHCGFGQVLEPTDV--------CVVNTDLFGGCS--KANNYGYKTNQPCIFLKLNKIFGWIP 192
            |....|.........|:        |..|....|.||  :..::||...:|||.:|:|:|.|::|
Zfish   186 RRNIACKGNAYFMQEDLEESAERKACQFNRSSLGACSGLQDKDFGYSKGRPCILVKMNRILGYLP 250

  Fly   193 EVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFPSYYYPF--- 254
                                   .:...|.|:|....| ..|....:::||:..|...|||:   
Zfish   251 -----------------------GQGTPVNVTCGLKKG-STEVLGEVKFFPNPNFDLRYYPYYGK 291

  Fly   255 LNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDR-KGSVTFQI 306
            |....|.||||||||.:......|.::|:...|.| .:.|..|| .|||:|.:
Zfish   292 LRHVNYSSPLVAVQFLNVQHDTPLHIQCKLNGKGI-INDSPTDRFLGSVSFTL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 88/304 (29%)
atp1b4XP_002664470.2 Na_K-ATPase 71..340 CDD:278704 86/298 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5399
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4678
OMA 1 1.010 - - QHG45736
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 1 1.000 - - mtm6361
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X254
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.