DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LUBEL and AT3G45570

DIOPT Version :10

Sequence 1:NP_723214.2 Gene:LUBEL / 33950 FlyBaseID:FBgn0031857 Length:2892 Species:Drosophila melanogaster
Sequence 2:NP_190143.1 Gene:AT3G45570 / 823699 AraportID:AT3G45570 Length:312 Species:Arabidopsis thaliana


Alignment Length:180 Identity:34/180 - (18%)
Similarity:59/180 - (32%) Gaps:71/180 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  2514 CELCM--NSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDE 2576
            |.:|.  |..| .|:.|:..|.|:.|.:|.|.:..|::....:..|.                  
plant   163 CSICSGDNIEP-EQIFSVALCGHEFCMECVKQHIEVKLLSGGVPRCL------------------ 208

  Fly  2577 HLEYFSNLDI-FLKSILDNDVHELFQRKLRDRSLLQDPNFKWCIQCSSGFFARPKQKRLICPD-- 2638
            |.:..|||.: ...:||.:.:..:::.::.:.|:                   |..:|:.||:  
plant   209 HYQCESNLTLGSCGNILTSKLKAMWELRIEEESI-------------------PVAERVYCPNPL 254

  Fly  2639 -------------------------CGSVTCAQCRKPWERQHEGSSCEAY 2663
                                     ||...|..|:.||   |...||..|
plant   255 CSSLMSVTKLSNSTREDVTMRTCVKCGEPFCINCKLPW---HSNLSCNDY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LUBELNP_723214.2 Bbox1_HOIP 89..132 CDD:380873
Activator_LAG-3 <326..451 CDD:151935
ZnF_RBZ 737..761 CDD:197784
RanBP2-type Zn finger 738..757 CDD:275376
HOIP-UBA 1036..1184 CDD:465229
PRK12323 <1291..>1402 CDD:481241
rne <1482..1771 CDD:236766
Not5 <1647..>2001 CDD:444384
DUF5585 <2138..>2378 CDD:465521
DamX <2154..>2254 CDD:442497
mRING-HC-C4C4_RBR_HOIP 2512..2565 CDD:438293 13/52 (25%)
BRcat_RBR_HOIP 2595..2671 CDD:438998 15/96 (16%)
Rcat_RBR_HOIP 2672..2756 CDD:439012
E3_UbLigase_RBR 2760..2858 CDD:436265
AT3G45570NP_190143.1 RNase_H_like 32..144 CDD:449355
RING_Ubox 162..214 CDD:473075 14/69 (20%)
BRcat_RBR_unk 244..301 CDD:439033 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.