DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LUBEL and AT3G45470

DIOPT Version :9

Sequence 1:NP_723214.2 Gene:LUBEL / 33950 FlyBaseID:FBgn0031857 Length:2892 Species:Drosophila melanogaster
Sequence 2:NP_190133.1 Gene:AT3G45470 / 823687 AraportID:AT3G45470 Length:222 Species:Arabidopsis thaliana


Alignment Length:246 Identity:65/246 - (26%)
Similarity:101/246 - (41%) Gaps:46/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2509 MLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQH 2573
            |..:.|.:|:.....::|..|.||||:.|..|......|::.:.::..|                
plant     1 MKGETCVICLEETKADRMFVMDKCLHRHCYPCVNQLVEVKLRNGTVPTC---------------- 49

  Fly  2574 EDEHLEYFSNLDIFLKS---ILDNDVHELFQRKLRDRSLLQDPNFK--WC--IQCS-----SGFF 2626
                |:|...|.:.|::   :|...|.||::..:::.|:   |..|  :|  |.||     :...
plant    50 ----LDYECKLKLSLENCFKVLKPKVIELWKHMMKEESI---PLAKRIYCPYINCSTLMSKTEIS 107

  Fly  2627 ARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLA--QNGID 2689
            ...|.....|..|..:.|..|:.||   |...||..|.  |...||.|....: :.||  |....
plant   108 RSNKSNDRACIKCSGLVCIDCKVPW---HSDLSCAEYK--KLHPDPVLDDLTL-KLLANDQKWRQ 166

  Fly  2690 CPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLG 2740
            |.||:....|.: ||.|.|| :|.::|||.|...:..| :.|..|.|.:.|
plant   167 CVKCRHLIELNQ-GCNHMTC-RCGYQFCYKCGVEWKKG-QVTCPTGCPRTG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LUBELNP_723214.2 Bbox1_HOIP 89..132 CDD:380873
Med15 <336..>483 CDD:312941
ZnF_RBZ 737..761 CDD:197784
RanBP2-type Zn finger 738..757 CDD:275376
HOIP-UBA 1036..1184 CDD:406963
PRK01741 1199..>1402 CDD:234977
rne <1482..1771 CDD:236766
Streccoc_I_II <2159..>2307 CDD:411384
RING-HC_RNF169 2513..2563 CDD:319465 12/49 (24%)
IBR 2598..2660 CDD:214763 17/70 (24%)
IBR <2690..2724 CDD:396187 14/33 (42%)
E3_UbLigase_RBR 2760..2858 CDD:407926
AT3G45470NP_190133.1 IBR 73..138 CDD:214763 17/70 (24%)
IBR 153..202 CDD:279784 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3901
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.