DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LUBEL and Arih2

DIOPT Version :9

Sequence 1:NP_723214.2 Gene:LUBEL / 33950 FlyBaseID:FBgn0031857 Length:2892 Species:Drosophila melanogaster
Sequence 2:NP_001012275.1 Gene:Arih2 / 316005 RGDID:1305839 Length:492 Species:Rattus norvegicus


Alignment Length:353 Identity:81/353 - (22%)
Similarity:135/353 - (38%) Gaps:80/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2408 SDDDYETSATEEEQEEPNLAEPQKAEQLKRKMSMPVFRAYPSVQEPVIEDPAILARKYVD----- 2467
            :::||:.:..|||:||   .:|...|.....::..|.:......:|  |:.......|.:     
  Rat    13 NEEDYDPNCEEEEEEE---EDPGDIEDYYVGVASDVEQQGADAFDP--EEYQFTCLTYKESEGAL 72

  Fly  2468 QELVTNIAEA----QIAATLVSMKFSEDVALWAARECSDLDQAI--AMLQ-------------QE 2513
            .|.:|::|.|    ...|.|:.:.|...|:....|..|:..|.:  |.:|             ..
  Rat    73 HEHMTSLASALKVSHSVAKLILVNFHWQVSEILDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHH 137

  Fly  2514 CELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSIN---DCSCPFCKL--------PEL 2567
            |.:||.......::| |.|.|:.|:.|.:.:.:|.:.| .:.   .|....|.|        |.|
  Rat   138 CAVCMQFVRKENLLS-LTCQHQFCRSCWEQHCSVLVKD-GVGVGISCMAQDCPLRTPEDFVFPLL 200

  Fly  2568 SNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCIQCSSGFFAR---P 2629
            .|| :..|::..|                  ||:..:.....||     .|.........|   |
  Rat   201 PNE-ELRDKYRRY------------------LFRDYVESHYQLQ-----LCPGADCPMVIRVQEP 241

  Fly  2630 KQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEW--KRENDPELQAQGVQEHLAQNGIDCPK 2692
            :.:|:.|..|..|.|.:||:.:   |..:.|....:|  |..:|.|     ...:::.:..||||
  Rat   242 RARRVQCNRCNEVFCFKCRQMY---HAPTDCATIRKWLTKCADDSE-----TANYISAHTKDCPK 298

  Fly  2693 CKFRYSLARGGCMHFTCTQCKFEFCYGC 2720
            |..... ..|||.|..|::||.:||:.|
  Rat   299 CNICIE-KNGGCNHMQCSKCKHDFCWMC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LUBELNP_723214.2 Bbox1_HOIP 89..132 CDD:380873
Med15 <336..>483 CDD:312941
ZnF_RBZ 737..761 CDD:197784
RanBP2-type Zn finger 738..757 CDD:275376
HOIP-UBA 1036..1184 CDD:406963
PRK01741 1199..>1402 CDD:234977
rne <1482..1771 CDD:236766
Streccoc_I_II <2159..>2307 CDD:411384
RING-HC_RNF169 2513..2563 CDD:319465 12/52 (23%)
IBR 2598..2660 CDD:214763 15/64 (23%)
IBR <2690..2724 CDD:396187 14/31 (45%)
E3_UbLigase_RBR 2760..2858 CDD:407926
Arih2NP_001012275.1 RING-HC_RBR_TRIAD1 136..189 CDD:319687 13/54 (24%)
IBR 207..269 CDD:214763 17/87 (20%)
IBR <297..329 CDD:396187 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1812
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.