DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11322 and ROS3

DIOPT Version :9

Sequence 1:NP_609071.2 Gene:CG11322 / 33949 FlyBaseID:FBgn0031856 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_200621.1 Gene:ROS3 / 835925 AraportID:AT5G58130 Length:748 Species:Arabidopsis thaliana


Alignment Length:201 Identity:41/201 - (20%)
Similarity:64/201 - (31%) Gaps:71/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDEMSIQQFSDSSSQS-EGDGEED-----------SND---ADDEEYQQPEWTGRKRPPLVYLEL 78
            :|.|:....|:|.::| :||..||           :||   :||..                 .|
plant   477 IDSMADDTVSNSMAESDDGDNVEDDTAIDSMCDDTANDDVGSDDSG-----------------SL 524

  Fly    79 GDKIIIVRNEPQPNVKLE-------DDVQLKTKMHKFLGLIPSRRKLYNPAVVYDMKPEDIENIN 136
            .|.:.....|..|   ||       |.|..|:.:.|.          .|.|...:.:.|.:....
plant   525 ADTVSDTSVEAVP---LEFVANTEGDSVDGKSNVEKH----------ENVAEDLNAEKESLVVKE 576

  Fly   137 CVVNSSHASAEPFTPSAEQPIRPKTMMTSTWSKLNLSNIDEPTPEESQAKSKNDFELWSIAFSFD 201
            .||:...|...|...|.:.......:..::|::|              ...||     :.:||..
plant   577 NVVDEEEAGKGPLKASNKSTGGSSWLQKASWTQL--------------VSDKN-----TSSFSIT 622

  Fly   202 QCTPDL 207
            |..|||
plant   623 QLFPDL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11322NP_609071.2 DUF45 278..422 CDD:302795
ROS3NP_200621.1 PLN03213 1..748 CDD:178752 41/201 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23099
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.