DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meng and Sbk2

DIOPT Version :9

Sequence 1:NP_001285688.1 Gene:meng / 33948 FlyBaseID:FBgn0031855 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001139801.1 Gene:Sbk2 / 381836 MGIID:2685925 Length:362 Species:Mus musculus


Alignment Length:285 Identity:86/285 - (30%)
Similarity:134/285 - (47%) Gaps:12/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YNIEKTLAEGCFAKILLCRHRPTNTLVVLKAVHAELTTIKEFQKEFHYNYELSHHHHILSAYAVA 165
            |...:.|.:|.|.::||..||...|.:.||.:..:.|:::.|..||.....|..|..|::||.:.
Mouse    62 YEEVRPLGQGRFGRVLLVTHRQKGTPLALKQLPKQSTSLRGFLYEFCVGLSLGTHSAIVTAYGIG 126

  Fly   166 FQTMDYYVFAMEHAPYGDLASNIGPN-GLHENACKLISEQLSSALGFMHSKNLVHRDLKIENILV 229
            .::.:.|.|..|...:|||.:.|.|. ||.:.|.:..:.||:|||..:||..||:||||.||:||
Mouse   127 IESANSYSFLTEPVLHGDLITFIQPKVGLPQPAAQRCAAQLASALEHIHSHGLVYRDLKPENVLV 191

  Fly   230 FTPDFTRVKLCDFGATTKKGLLVH----KVKHTWTS-CVPPEQLELIKNERFQCLPVSDSWQFGI 289
            ..|...||||.|||.|..:|.|:.    .:.:|... |.||...|.:..:     |..|:|..|:
Mouse   192 CDPACQRVKLTDFGHTRPRGTLLRLTGPPIPYTAPELCAPPPLPEGLPIQ-----PSLDAWALGV 251

  Fly   290 LLYNILTGNPPWQSADWVKDQSYANFMKYE-QRKTTKVPDNFRRFSPRLMRCFRKYLSHDPEDRC 353
            |::.:|||..||.......|..:.:|:.:: ..:....|..:...||.........|...|..|.
Mouse   252 LIFCLLTGYFPWDQPLVEVDPFFEDFLIWQASGQPQDRPQPWYSLSPAADTLLWGLLDPHPRKRN 316

  Fly   354 KITEVAKYMKDRWVECRISTSKSAT 378
            .:..:..|:...|.:......:.||
Mouse   317 PVGSIKSYLGQPWKQREGEAEELAT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mengNP_001285688.1 STKc_SBK1 107..366 CDD:270889 82/265 (31%)
Sbk2NP_001139801.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PKc_like 68..329 CDD:389743 82/265 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..362 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3891
eggNOG 1 0.900 - - E1_KOG1345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4135
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8812
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X768
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.