DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meng and Sbk1

DIOPT Version :9

Sequence 1:NP_001285688.1 Gene:meng / 33948 FlyBaseID:FBgn0031855 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_671476.1 Gene:Sbk1 / 113907 RGDID:628713 Length:417 Species:Rattus norvegicus


Alignment Length:322 Identity:106/322 - (32%)
Similarity:161/322 - (50%) Gaps:45/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PGAASVSRRSSIYKKPDKNDGGQIHLIPDVELPLMT---------------FADQYNIEKTLAEG 110
            ||||.|                     |...:||:|               ....|.:.:.|.:|
  Rat    19 PGAAPV---------------------PGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKG 62

  Fly   111 CFAKILLCRHRPTNTLVVLKAVHAELTTIKEFQKEFHYNYELSHHHHILSAYAVAFQTMDYYVFA 175
            .:.|:.|..::.|.|.:.||.|:...|.:|.|.:|......||....|:..:.|.|:|.:.||||
  Rat    63 TYGKVDLVAYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEECYVFA 127

  Fly   176 MEHAPYGDLASNIGPN-GLHENACKLISEQLSSALGFMHSKNLVHRDLKIENILVFTPDFTRVKL 239
            .|:||.|||...|.|. ||.|:..|...:||..||.||||:.|||||:|.||:|:|..:..||||
  Rat   128 QEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHSRQLVHRDIKPENVLLFDRECRRVKL 192

  Fly   240 CDFGATTKKGLLVHKVKHTWTSCVP---PEQLELIKNERFQCLPVSDSWQFGILLYNILTGNPPW 301
            .|||.|.:.|..|.:|..|    :|   ||..:..:.:.|......|.|.||:|::.:||||.||
  Rat   193 ADFGMTRRVGCRVKRVSGT----IPYTAPEVCQAGRADGFAVDTGVDVWAFGVLIFCVLTGNFPW 253

  Fly   302 QSADWVKDQSYANFMKYEQRKTTKVPDNFRRFSPRLMRCFRKYLSHDPEDRCKITEVAKYMK 363
            ::|... |..:..|:::::.:...:|..:|||:...:|.|::.|:.:||.|....||.:::|
  Rat   254 EAASGA-DAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEPERRGPAKEVFRFLK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mengNP_001285688.1 STKc_SBK1 107..366 CDD:270889 96/261 (37%)
Sbk1NP_671476.1 S_TKc 53..316 CDD:214567 97/267 (36%)
STKc_SBK1 59..317 CDD:270889 96/261 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348946
Domainoid 1 1.000 165 1.000 Domainoid score I3818
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 1 1.000 - - FOG0002130
OrthoInspector 1 1.000 - - mtm9059
orthoMCL 1 0.900 - - OOG6_106722
Panther 1 1.100 - - O PTHR24359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X768
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.