DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meng and sbk2

DIOPT Version :9

Sequence 1:NP_001285688.1 Gene:meng / 33948 FlyBaseID:FBgn0031855 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_002938316.1 Gene:sbk2 / 100492557 XenbaseID:XB-GENE-6045354 Length:310 Species:Xenopus tropicalis


Alignment Length:280 Identity:85/280 - (30%)
Similarity:149/280 - (53%) Gaps:10/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LPLMTFADQYNIEKTLAEGCFAKILLCRHRPTNTLVVLKAVHAELTTIKEFQKEFHYNYELSHHH 156
            |..|..:|.|.:.|.|..|.:.:::|..||...|.:.||.:....|..:.|..|:.....||.|.
 Frog    24 LTSMEVSDNYKVIKELGRGKYGQVILVIHRQRGTPMALKLLPKMHTKKQNFLYEYCVALTLSAHT 88

  Fly   157 HILSAYAVAFQTMDYYVFAMEHAPYGDLASNIGP-NGLHENACKLISEQLSSALGFMHSKNLVHR 220
            :|:..:.:||::.::|.|..|.|...||.|.|.| .|:.|.|.|..::||.|||.|:||:.||:|
 Frog    89 NIIGMFGIAFESAEHYGFLYEAALQRDLISIIKPREGVPEQAGKQCTKQLVSALEFIHSRGLVYR 153

  Fly   221 DLKIENILVFTPDFTRVKLCDFGATTKKGLLVHKVKHTWTSCVPPEQLELIKNERFQCLPVS--- 282
            |:|.||:|:|..|..|:||.|||.|..:|.::..|    :..:|....||......:.:|:.   
 Frog   154 DVKPENVLLFGRDCQRIKLTDFGLTRPRGTMLKLV----SGIIPYTAPELSNTRNGEGMPIDFAL 214

  Fly   283 DSWQFGILLYNILTGNPPWQSADWVKDQSYANFMKYEQRKTTK-VPDNFRRFSPRLMRCFRKYLS 346
            |||.||:||:.::||..||:.. ...|..:.:::.:::..::: :..::::.:...|....|.::
 Frog   215 DSWAFGVLLFCLMTGYFPWEKT-LPSDPFFEDYVVWQETGSSEDLSRHWKKLTAESMDMLSKLMA 278

  Fly   347 HDPEDRCKITEVAKYMKDRW 366
            .:|.:|..:.:..||:...|
 Frog   279 LNPSERSPVNKALKYLDSPW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mengNP_001285688.1 STKc_SBK1 107..366 CDD:270889 79/263 (30%)
sbk2XP_002938316.1 PKc_like 39..298 CDD:419665 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3848
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221624at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9478
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X768
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.