DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3A and Kprp

DIOPT Version :10

Sequence 1:NP_609069.1 Gene:TTLL3A / 33947 FlyBaseID:FBgn0031854 Length:992 Species:Drosophila melanogaster
Sequence 2:NP_082905.1 Gene:Kprp / 433619 MGIID:1920981 Length:657 Species:Mus musculus


Alignment Length:141 Identity:37/141 - (26%)
Similarity:48/141 - (34%) Gaps:40/141 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RPSSEPH--------RSRDQVTDGDRNR---------DQPQKCASATLAKKPVTPPAAPP----- 46
            ||.::||        :..|:..:..|.|         .:||.|.|......|...|...|     
Mouse   419 RPRADPHPFPRSCRPQHLDRSPESSRQRCPVPAPRPYPRPQPCPSPEPRPYPRPQPCPSPEPRPR 483

  Fly    47 ------PTPSNRVVAPL---TVPVIQLTPAQSDSPVKLARPATPKETAISVPDHSNKENQPARTP 102
                  |:|..|...||   :.|.:...|..:..||  ..|| |:......|.|.  || |...|
Mouse   484 PCPQPCPSPEPRPCPPLRRFSEPCLYPEPCSAPQPV--PHPA-PRPVPRPRPVHC--EN-PGPRP 542

  Fly   103 PPSKSCPLGAP 113
            .|   |||..|
Mouse   543 QP---CPLPHP 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3ANP_609069.1 TTL 342..640 CDD:397308
KprpNP_082905.1 PHA03247 <281..588 CDD:223021 37/141 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..493 12/67 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..568 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.