DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3A and TTLL1

DIOPT Version :10

Sequence 1:NP_609069.1 Gene:TTLL3A / 33947 FlyBaseID:FBgn0031854 Length:992 Species:Drosophila melanogaster
Sequence 2:NP_036395.1 Gene:TTLL1 / 25809 HGNCID:1312 Length:423 Species:Homo sapiens


Alignment Length:88 Identity:26/88 - (29%)
Similarity:36/88 - (40%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EVFHWFLK-ISLLRIFDDDFLVAPVPTTLFQFHETELVVSLGVILLHAYCYRNDLDTIILSVSAF 83
            :.||...| :|.:.: .|.|||....||...|..|..|..|.       |.|      |||.|. 
Human   337 KAFHTLHKELSSVSV-GDQFLVHHSETTEVVFEGTRKVNILS-------CER------ILSKSR- 386

  Fly    84 VSAFELMLKING----MVYRRKQ 102
             .|.:|.|.:.|    :::.:||
Human   387 -EAAQLPLYMEGGFVEVIHDKKQ 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3ANP_609069.1 TTL 342..640 CDD:397308
TTLL1NP_036395.1 TTL 59..364 CDD:397308 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..423 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.