DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and ttll9

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_001243693.1 Gene:ttll9 / 556794 ZFINID:ZDB-GENE-030131-1582 Length:435 Species:Danio rerio


Alignment Length:235 Identity:76/235 - (32%)
Similarity:124/235 - (52%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 NLWILKPGYQSRGIGIVIRSSLDDILQWTSNN----------QNKKYIVQKYIERPLLIYRTKFD 455
            |.||:||..:|:|.||.:...|.||:.|..:.          |.:.|:.|:|||.|.||...|||
Zfish   146 NTWIMKPVARSQGKGIFLFRKLKDIIDWRKDGSRSEEQKDEAQVESYVAQRYIENPYLIAGRKFD 210

  Fly   456 IRQYMLLTITDTKVSIWTYRDCYLRFSSQEFTMDDLRES-IHLTNNSVQKRYKNKTNRDSRLPKN 519
            :|.|:|:| :...:..|.|||.:.|||:..|::..:.:. :||||.:||     ||..|....|.
Zfish   211 LRVYVLVT-SYIPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQ-----KTAPDYDPEKG 269

  Fly   520 NMWSLDQFKNYLRIMGAPDG------SWSKTYNGFKQNLVAVVMASLDETELLQNAFELYGCDFM 578
            ..|.:.|.:.||.   |..|      .:.:..|.|.::|::|....:::    ::.|||||.|.:
Zfish   270 CKWQMQQLRWYLT---AKHGFETVQTLFKEIDNVFIRSLLSVQKTIIND----KHCFELYGYDIL 327

  Fly   579 LDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVV 618
            ||:...|.|||:|::|.|:.|::....:...:|:|.:.:|
Zfish   328 LDQDLKPWLIEVNASPSLTASSQEDYDLKYRLLEDTLHIV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 76/235 (32%)
ttll9NP_001243693.1 TTL 76..367 CDD:281171 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.