DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and KPRP

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_001020402.1 Gene:KPRP / 448834 HGNCID:31823 Length:579 Species:Homo sapiens


Alignment Length:82 Identity:21/82 - (25%)
Similarity:32/82 - (39%) Gaps:19/82 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GGSSSMG--------SNNFSPDSIGNLLARVRASTPLPRTVTS-SPTAPEAQKR--------QMR 125
            |..||.|        .||::|..  .|.....:..|..|:.|| ||..|:.|.:        |.|
Human   186 GSYSSCGPQFQSRATCNNYTPQF--QLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHR 248

  Fly   126 NVYRTRVIDAYRNRRIF 142
            :...:|.:...|..::|
Human   249 SRSTSRCLPPPRRLQLF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171
KPRPNP_001020402.1 PHA03247 <250..534 CDD:223021 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..579
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.