powered by:
Protein Alignment TTLL3B and Kprp
DIOPT Version :9
Sequence 1: | NP_609068.2 |
Gene: | TTLL3B / 33946 |
FlyBaseID: | FBgn0031853 |
Length: | 756 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082905.1 |
Gene: | Kprp / 433619 |
MGIID: | 1920981 |
Length: | 657 |
Species: | Mus musculus |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 25/57 - (43%) |
Gaps: | 3/57 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 693 KVVE--APAKNVKNPTAKITKKKKLSASAG-SSTAASAQPSTQNLTTKLILNPATRE 746
||:| ||.....:.||..:...::...|. .:|....|...|:.||::...|.|.|
Mouse 44 KVLECAAPCPVQVSQTACQSSTTEVKGQAPCKTTKGKCQAPCQSKTTQVKYQPKTTE 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167838219 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.