DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and Kprp

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_082905.1 Gene:Kprp / 433619 MGIID:1920981 Length:657 Species:Mus musculus


Alignment Length:57 Identity:16/57 - (28%)
Similarity:25/57 - (43%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 KVVE--APAKNVKNPTAKITKKKKLSASAG-SSTAASAQPSTQNLTTKLILNPATRE 746
            ||:|  ||.....:.||..:...::...|. .:|....|...|:.||::...|.|.|
Mouse    44 KVLECAAPCPVQVSQTACQSSTTEVKGQAPCKTTKGKCQAPCQSKTTQVKYQPKTTE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171
KprpNP_082905.1 PHA03247 <281..588 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..493
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.