DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL6B

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_651549.1 Gene:TTLL6B / 43282 FlyBaseID:FBgn0039501 Length:720 Species:Drosophila melanogaster


Alignment Length:507 Identity:111/507 - (21%)
Similarity:178/507 - (35%) Gaps:181/507 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 VREHQPAELISENGTIFSTTLDFA-LGKVKKMVRHAEHYSLDDARIKPPTPAEIVENQTFMVQST 357
            |.|.:||.  ....||..:...:| :||:.|.:    .|.|    :|......|:.:.:|  ...
  Fly   135 VDEERPAS--ETKSTICVSNSRYAMIGKISKTL----GYKL----VKESKMWNILWSDSF--PGV 187

  Fly   358 DVLKSNAKFKVSEKV--MAEYAR--LAGLYLDQIESLRP-DYR-----WD-------------GS 399
            ::.|:..:|:.....  |.|..|  |....|:::..:.| ||:     |.             ..
  Fly   188 ELFKNMKRFQQINHFPGMIEICRKDLLSRNLNRMLKIFPQDYKIFPKTWMLPADYGDAMNYALNH 252

  Fly   400 RNLWILKP--GYQSRGIGIVIRSSLDDILQWTSNN-----QNKKYIVQKYIERPLLIYRTKFDIR 457
            :..:||||  |.|.|||             |.:|:     .:::.|.|.||.|||||...|||:|
  Fly   253 KRTFILKPDSGAQGRGI-------------WLTNDLKTIGPHERLICQTYIHRPLLIDGYKFDLR 304

  Fly   458 QYMLLTITDTKVSIWTYRDCYLRFSSQEF------TMDDLRESIHLTNNSVQKR---YKNKTNRD 513
            .|.|:|..| .:.|:.|.:...||::.::      ..:||  .:||||.||.||   |:...|.|
  Fly   305 VYTLITSVD-PLRIFVYNEGLARFATNKYVEPTPGNANDL--YMHLTNYSVNKRNSHYELCDNDD 366

  Fly   514 ----SRLPKNNMW------SLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAV-------VMASLD 561
                .:|...|.|      .:::|             ||...:...:.:::.       ..|...
  Fly   367 CGSKRKLSAINNWMRRHNYDVEEF-------------WSNVDDVIIKTVLSAWPVLKHNYHACFP 418

  Fly   562 ETELLQNAFELYGCDFMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPT 626
            ..:.:|..||:.|.|.::|....|.::|:|.:|....:.::...:                |.| 
  Fly   419 GHDKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREV----------------KRP- 466

  Fly   627 AATGLFELAFEVNYSINKGADGKPLELNGKQMTLFENMPRMRNSPRTRLLRKILNNVKTSTTKKV 691
                                                            |:|..||.|.|....| 
  Fly   467 ------------------------------------------------LIRDTLNLVSTVLADK- 482

  Fly   692 EKVVEAPAKNVKNPTAKI--------------TKKKKLSASAGSSTAASAQP 729
            .::::...|.||....||              |.|.|:.|..||   ..|||
  Fly   483 RQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTSKPKIDAQKGS---PDAQP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 79/356 (22%)
TTLL6BNP_651549.1 TTL 196..486 CDD:281171 81/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.