DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL6A

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_611433.3 Gene:TTLL6A / 37253 FlyBaseID:FBgn0034459 Length:867 Species:Drosophila melanogaster


Alignment Length:495 Identity:111/495 - (22%)
Similarity:180/495 - (36%) Gaps:129/495 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QERWYREDGVCGMSYPRFYRLGGNNLEERMAFIEDYQQTQARSLLLYVRE---------HQPAEL 302
            |..|.|             |.||.|.:..|...:|..|.|....||...:         .:|...
  Fly    63 QPTWRR-------------RGGGVNEDHIMVVTQDNTQQQRDKPLLTASQLDSICYDVIKEPPMQ 114

  Fly   303 ISENGTIFSTTL------------DFALGKVKKMVR-----HAEHYSLDDARIKPPTPAEIVENQ 350
            ...|||....::            .|.|  |.|:.|     |...:.|.:.:....||..     
  Fly   115 FHVNGTDIVPSIRGLRLSVCVEHTRFQL--VAKVTRNMGFQHVPEHRLWNIQWSDSTPHH----- 172

  Fly   351 TFMVQSTDVLKSNAKFKVSEKV--MAEYAR--LAGLYLDQIESLRP-DYR-----W--------- 396
                   |:|::..:|:.....  |.|..|  |....|:::..:.| |||     |         
  Fly   173 -------DLLRNMKRFQQINHFPGMVEICRKDLLSRNLNRMLKMFPGDYRIFPKTWLMPTDAYDV 230

  Fly   397 ----DGSRNLWILKPGYQSRGIGIVIRSSLDDILQWTSNNQNKKYIVQKYIERPLLIYRTKFDIR 457
                :..:..:||||....:|.||.|.:.|..:      .:.:|.|.|.||||||||...|||:|
  Fly   231 AIYANKHKRTFILKPYSAGQGRGIWITTDLRTV------GKREKLICQTYIERPLLIDGYKFDLR 289

  Fly   458 QYMLLTITDTKVSIWTYRDCYLRFSSQEFTMDDLRES----IHLTNNSVQKRYKN-------KTN 511
            .|.|:|..| .:.|:.|.:...||::|::.......|    :||||..:.:|...       :..
  Fly   290 VYTLVTSVD-PLRIFVYNEGLARFATQKYVPPTTGNSHNVFMHLTNYCLNRRNSQYMVGNGPEAG 353

  Fly   512 RDSRLPKNNMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQNAFELYGCD 576
            ...:|...|.|.:|...:......:.|.:..||.......|.........:.:.:|.:|:|.|.|
  Fly   354 SKRKLSAFNKWLVDHNYDVGEFWASVDDAIIKTLISAWPTLKHNYNVCFPKHDKIQASFQLLGFD 418

  Fly   577 FMLDEHYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPTAATGLFELAFEVNYS 641
            .::|....|.::|:|.||.||....:...:...:::|.:.::         :|.|.:        
  Fly   419 ILVDWKLKPYILEVNHTPSLSADESVDMEVKRPLIRDTLNML---------STALVD-------- 466

  Fly   642 INKGADGKPLELNGKQMTLFENMPRMRNSPRTRLLRKILN 681
                          |:..:.::    |...|.||||.|.|
  Fly   467 --------------KEQIIRDD----RTEHRARLLRNIYN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 79/339 (23%)
TTLL6ANP_611433.3 TTL 181..471 CDD:281171 75/327 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.