DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL3B and TTLL12

DIOPT Version :9

Sequence 1:NP_609068.2 Gene:TTLL3B / 33946 FlyBaseID:FBgn0031853 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_610325.1 Gene:TTLL12 / 35732 FlyBaseID:FBgn0033225 Length:626 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:106/253 - (41%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 GSRNLWILKPGYQSRGIGIVIRSSLDDILQWTSNNQNKKYIVQKYIERPLLIYR------TKFDI 456
            |..|.||:||...:||:...|..::..|::..:....   |.|||||||:|..|      .||||
  Fly   391 GLDNHWIIKPWNLARGLDTHITDNIKQIVRLPATGPK---IAQKYIERPVLFSRQEVEGSVKFDI 452

  Fly   457 RQYMLLTITDTKVSIWTYRDCYLRFSSQEFTMD--DLRESIHLTNNSVQKRYKNKTNRDSRLPKN 519
            | |::|..:...:..:.:|..:|||::..||:|  |..|..:...|...:...:....|..|   
  Fly   453 R-YVILLKSVKPLKAYIHRKFFLRFANHPFTLDHFDDYEKHYTVMNYQTEAQLHHVKCDDFL--- 513

  Fly   520 NMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQNAFE------------- 571
            .:|. :|:         ||..||    ..:|.:.::::      |:||.|.:             
  Fly   514 TLWQ-EQY---------PDNDWS----ALEQQICSMLL------EVLQCASQADPPCGLAPCAQS 558

  Fly   572 --LYGCDFML------DEHYNPILIEINSTPDLSPSTEITARIC---PMVLKDCIRVV 618
              ||..|.||      ::...|.|:|||.|||..       |.|   |....|..|::
  Fly   559 RALYAADIMLRWKDDKEKLMEPQLLEINWTPDCK-------RACDYYPDFFNDIFRLL 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL3BNP_609068.2 TTL 325..626 CDD:281171 68/253 (27%)
TTLL12NP_610325.1 ATP-grasp_4 328..613 CDD:302634 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.